DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CG11192

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:262 Identity:78/262 - (29%)
Similarity:120/262 - (45%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WVLILFARS-------SNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNK 64
            |::.|.|.:       ...|..|..|....:.:..||.:.|.|.||||:|....|||||.|.::.
  Fly     9 WLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDP 73

  Fly    65 -PVKRITVRVGTPDIYRGGRIIRVTALVVHENY--KNWDNDIALLWLEKPV-LSVRVTKIPLA-- 123
             .....|||||:.:...||.::.:..::.|.:|  ::.|||:|||.|...: .:..:..:|||  
  Fly    74 WSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAAL 138

  Fly   124 TKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAE-ELVE------------PVGE 175
            ...|:.:.....:|||.:..||.|      :|...:.|:....: :|||            |:..
  Fly   139 ADPPTADTRLQVSGWGFQAEESAV------SGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITR 197

  Fly   176 ELLCAFYTENDICPGDYGGPLV--LAN----KVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEEN 234
            .::||.....|.|.||.|||||  .|.    ::.||...|.||.....|.:||||..:..||:|.
  Fly   198 RMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQ 262

  Fly   235 AE 236
            .:
  Fly   263 LD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 74/239 (31%)
Tryp_SPc 19..231 CDD:214473 72/236 (31%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 72/237 (30%)
Tryp_SPc 28..262 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.