DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CG13744

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:112/249 - (44%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGR 83
            |..|..|:|..:.:.|.:.::.| :|||.:|.:.:|.|||.|::...:..|||.:|..|....|.
  Fly   142 IIGGRPAQFAEYPWQAHIRIAEY-QCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQDLGH 205

  Fly    84 IIR--------VTALVVHENYKNW-----DN-DIALLWLEKPVLSVRVTKIPLATKEPSENEYPS 134
            |..        |...::|..: |:     |. |||||.|.:|. |.....:|:...     :||.
  Fly   206 IHEPLPVEKHGVLQKIIHPRF-NFRMTQPDRYDIALLKLAQPT-SFTEHILPICLP-----QYPI 263

  Fly   135 N--------AGWGE-KLLESYVVTRKLQNGVTKIRPRSMC-----AEELVEPVGEELLCAFYTEN 185
            .        ||||: :....:..|..||.....|.....|     ::::...:..|:.||.:::.
  Fly   264 RLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDG 328

  Fly   186 --DICPGDYGGPLVLANK----VVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEE 233
              |.|.||.|||||:..:    :|||...|.|||....|.:|.||...:.||:|
  Fly   329 HMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 72/249 (29%)
Tryp_SPc 19..231 CDD:214473 69/245 (28%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 69/245 (28%)
Tryp_SPc 142..383 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.