DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and OVCH1

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:241 Identity:73/241 - (30%)
Similarity:115/241 - (47%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCV--KNKPVKRITVRVGTPDI 78
            |..|..|.||....|.:...:...|.::||||:|:...:||||.||  ||.|:. .|:..|..| 
Human   607 SRRIAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLS-WTIIAGDHD- 669

  Fly    79 YRG-----GRIIRVTALVVHENYK--NWDNDIALLWLEKPV---LSVRVTKIPLATKEPSENEYP 133
             |.     .::.|...::|||::.  ::|:||||:.|..|:   ..||...:|.:.:....:|..
Human   670 -RNLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEIC 733

  Fly   134 SNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEEL--VEPVG--EELLCAFYT---ENDICPGD 191
            :..|||....:..:.:| ||.....:..|.:|....  ..|.|  |:::||.:.   |.|.|.||
Human   734 AVTGWGSISADGGLASR-LQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGD 797

  Fly   192 YGGPLVLANK-----VVGIAVQGHGCGFAVLPSLYTNVFHYLEWIE 232
            .|||||..::     :.||...|.||.....|.::..|..:|:||:
Human   798 SGGPLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWIQ 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 72/238 (30%)
Tryp_SPc 19..231 CDD:214473 70/235 (30%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001
CUB 454..565 CDD:238001
Tryp_SPc 610..845 CDD:238113 72/238 (30%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.