DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CLIPB3

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_307750.3 Gene:CLIPB3 / 3290783 VectorBaseID:AGAP003249 Length:365 Species:Anopheles gambiae


Alignment Length:234 Identity:75/234 - (32%)
Similarity:109/234 - (46%) Gaps:49/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GYHECGGAVIDSRIVLTAAQCVKNKP----VKRITVRVGTPDIYRGGRI-----------IRVTA 89
            |:| |||::|:.|.::|||.|:|:.|    |.|  ||:|..|:......           :.:..
Mosquito   140 GFH-CGGSLINDRYIVTAAHCIKSIPRGWKVHR--VRLGEWDLTSANDCQNEFCSDAPIDLDIEQ 201

  Fly    90 LVVHENYKNWD----NDIALLWLEKPV---LSVRVTKIPLATKEPSENE--YPS-NAGWGEKLLE 144
            :|||..|...|    |||||:...:||   .:||...:||::...:.|.  .|: .||||:  .|
Mosquito   202 IVVHTGYDTKDQSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRNHAGMPAYAAGWGK--TE 264

  Fly   145 SYVVTRKLQNGVTKIRPRSMCAEELVEPV---GEELL-----CAFYTE-NDICPGDYGGPLVLAN 200
            |...:.|.......|:....||     ||   |..||     ||.... .|.|.||.||||:...
Mosquito   265 SATASEKKLKVEMNIKSLQECA-----PVYQRGGILLKKTHMCAGGVRGKDTCSGDSGGPLMRQM 324

  Fly   201 K----VVGIAVQG-HGCGFAVLPSLYTNVFHYLEWIEEN 234
            .    ::|:...| ..||...:|.:||||..|::||::|
Mosquito   325 SGSWYLIGVVSFGPQKCGAPGVPGVYTNVAEYVDWIKDN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 74/232 (32%)
Tryp_SPc 19..231 CDD:214473 72/229 (31%)
CLIPB3XP_307750.3 CLIP 37..89 CDD:288855
Tryp_SPc 112..360 CDD:214473 72/229 (31%)
Tryp_SPc 113..363 CDD:238113 74/232 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.