DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and CG32834

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:268 Identity:78/268 - (29%)
Similarity:113/268 - (42%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WVLILFARSS------------NGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQ 59
            |.:.||..::            :.|..|.:...:...:.|.|.:.|...|.||:|.|..::|||.
  Fly     3 WSVFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAAS 67

  Fly    60 CVKNKPVKRITVRVGTPD-IYRG-GRIIRVTALVVHENYKNW--DNDIALLWLEKPV-LSVRVTK 119
            ||::  ...|.|||||.. .|.| |.::.|..::.|..|..|  ||::|||.|..|: .|..:..
  Fly    68 CVQS--YGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQP 130

  Fly   120 IPLATKEPSENEYPSNAGWGEK------------LLESYVVTRKLQNGVTKIRPRSMCAEE---- 168
            |.:|..||.:..:.:.:|||..            .|..|     ||.....:..|..||.:    
  Fly   131 ISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDY-----LQMAWVSVYNREQCAADRGVW 190

  Fly   169 ---LVEPVGEELLCAFYTENDI--CPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYL 228
               ....:....||   |.|..  |..|.|.|||:..::|||..:| ||  ...|.:|.||..:.
  Fly   191 FGLWDNGISYLTLC---THNGAGGCSYDTGAPLVIDGQLVGILSEG-GC--TTKPDVYANVPWFT 249

  Fly   229 EWIEENAE 236
            .||.||.|
  Fly   250 GWIAENTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 72/240 (30%)
Tryp_SPc 19..231 CDD:214473 70/237 (30%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 70/238 (29%)
Tryp_SPc 27..255 CDD:238113 72/240 (30%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.