DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:246 Identity:79/246 - (32%)
Similarity:112/246 - (45%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRI-TVRVG 74
            |...|...|..|::|:...|.:..|:.::..|.||||:|.:..|||||.|.|:.|..:. |...|
Mouse   178 LITLSEERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPNPQYWTATFG 242

  Fly    75 TPDIYRGGRIIRVTALVVHENYKN--WDNDIALLWLEKPVL---SVRVTKIPLATKEPSENEYPS 134
            ...:....| :||.|::.|:.|.:  .|||||::.|::.|.   ::....:|.||    :|..|.
Mouse   243 VSTMSPRLR-VRVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAAT----QNIIPG 302

  Fly   135 N----AGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEE------LLCAFYTEN--DI 187
            :    .|||........||...|..|     |.:.:||...|.|..      :|||.....  |.
Mouse   303 SVAYVTGWGSLTYGGNAVTNLRQGEV-----RIISSEECNTPAGYSGSVLPGMLCAGMRSGAVDA 362

  Fly   188 CPGDYGGPLVLANK-----VVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEE 233
            |.||.|||||..:.     ||||...|:.||....|.:||.|..|..||.:
Mouse   363 CQGDSGGPLVQEDSRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQ 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 77/238 (32%)
Tryp_SPc 19..231 CDD:214473 75/234 (32%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 75/235 (32%)
Tryp_SPc 186..414 CDD:238113 77/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.