DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:226 Identity:66/226 - (29%)
Similarity:95/226 - (42%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKR-ITVRVGTPDIYRGG 82
            |..|.....:...:..|:....||.||.::|.|...||||.|:...|..| |::..||.....||
Mosquito    54 IVGGEPVSIETHVYQLSLRSYDYHICGASIISSVWALTAAHCLFPDPDPRTISLLAGTGSQSTGG 118

  Fly    83 RIIRVTALVVHENY--KNWDNDIALLWLEKPVLSVRVTK------------IPLATKEPSENEYP 133
            ||...|.:::|..|  ...|||:|:         :||..            :||. .||......
Mosquito   119 RIYNATRIIIHPMYAPSTMDNDVAV---------IRVNTHFSGPNTGYIGVVPLG-YEPMAGVRA 173

  Fly   134 SNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEE----LVEPVGEELLCAFYTENDICPGDYGG 194
            ...|||.: .|....:..|......|..::.|.::    ||.|   :::||.....|.|.||.||
Mosquito   174 IVTGWGRQ-SEGAKQSMTLAGVEIPIVDKAECMDQWSGVLVSP---QMICAGELGKDSCNGDSGG 234

  Fly   195 PLVLANKVVGIAVQGH-GCGFAVLPSLYTNV 224
            |||...:.:||...|. .|| ..|.::|||:
Mosquito   235 PLVSGGRQIGIVSWGSTKCG-GPLAAIYTNL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 66/226 (29%)
Tryp_SPc 19..231 CDD:214473 66/226 (29%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 66/226 (29%)
Tryp_SPc 54..276 CDD:238113 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.