DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP004741

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_318080.4 Gene:AgaP_AGAP004741 / 1278484 VectorBaseID:AGAP004741 Length:315 Species:Anopheles gambiae


Alignment Length:219 Identity:56/219 - (25%)
Similarity:90/219 - (41%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTALV--VHENYKNW--DNDIA 104
            |||::|:::.|||||.|..:..|    .::|...|:.....:.::.::  ||..:..|  .||:|
Mosquito    99 CGGSLIEAQWVLTAAHCANDYTV----FQIGLGSIHLNMARLTMSTVIKFVHPEFDPWKLTNDVA 159

  Fly   105 LLWLEKPV-LSVRVTKIPLATKEPSENEYPSN----AGWGE--------KLLESYVVTRKLQN-- 154
            |:.|..|| .|:.:..:.|....|..:.|...    :|:|.        ..:..|...|.:.|  
Mosquito   160 LIRLPSPVPYSLEIYPVKLPINLPPTDLYIGRQVTVSGFGRTSDAIQSISTILKYERMRIISNAE 224

  Fly   155 -----GVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANK-----VVGIA--V 207
                 |...||..::||.....|.           .::|.||.|||:|:...     .:||.  |
Mosquito   225 CTNVYGAAIIRNTTLCAVGWERPY-----------QNVCQGDSGGPMVMQQDDSSWVQIGIVSFV 278

  Fly   208 QGHGCGFAVLPSLYTNVFHYLEWI 231
            ...||.... ||.|....:||.|:
Mosquito   279 SSRGCSTGD-PSGYIRTVNYLSWL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 56/219 (26%)
Tryp_SPc 19..231 CDD:214473 55/217 (25%)
AgaP_AGAP004741XP_318080.4 Tryp_SPc 70..300 CDD:214473 55/216 (25%)
Tryp_SPc 71..304 CDD:238113 56/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.