DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP004900

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_314989.4 Gene:AgaP_AGAP004900 / 1275705 VectorBaseID:AGAP004900 Length:265 Species:Anopheles gambiae


Alignment Length:265 Identity:77/265 - (29%)
Similarity:118/265 - (44%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LIGSCWVLILFARSSNG------IYNGVEAKFDFWTFLASV-WVSGYHECGGAVIDSRIVLTAAQ 59
            ||.|..:|:....:.:|      |.||.:|..:.:.|:.|: ..||.|.|||::::.|.:||||.
Mosquito     8 LILSFLLLLSIIHALSGPIDQSKIVNGTDAAIENYPFVVSLRGASGGHSCGGSILNDRWILTAAH 72

  Fly    60 CVKNKPVKRITVRVGTPDIYR--GGRIIRVTALVVHENYKNWD---NDIALLWLEKPVL---SVR 116
            ||........|::||..||.|  ...:..:..:|:|..|...|   :|||||.|.||::   .|:
Mosquito    73 CVDYTTPLYQTIQVGRADISRTEDESVYAIEDVVIHPGYNPADSYIDDIALLKLRKPLVFTDQVQ 137

  Fly   117 VTKIPLATKE--PSENEYPSNAGWGEKL-----------LESYVVTRKLQNGV--TKIRPRSMCA 166
            ..::|....|  ..|:...:..|||...           ::.|.|.....|.:  ..|.|..:||
Mosquito   138 PVRLPKRFFEIDVQESNLVTLVGWGRNASDGPVQTTLQEIDYYAVPNDECNRIHSNHIYPTQICA 202

  Fly   167 EELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQG-HGCGFAVLPSLYTNVFHYLEW 230
               .||.|.:         ..|.||.||||:.....|||.... ..|..|..|.:.|.|.:|:::
Mosquito   203 ---AEPGGGK---------GQCSGDSGGPLIYKEFQVGIVSWSIKPCAIAPYPGVLTKVSYYVDF 255

  Fly   231 IEENA 235
            |.::|
Mosquito   256 INQHA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 71/239 (30%)
Tryp_SPc 19..231 CDD:214473 70/236 (30%)
AgaP_AGAP004900XP_314989.4 Tryp_SPc 30..256 CDD:214473 70/237 (30%)
Tryp_SPc 31..259 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.