| Sequence 1: | NP_608665.1 | Gene: | CG4271 / 33410 | FlyBaseID: | FBgn0031409 | Length: | 242 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_314989.4 | Gene: | AgaP_AGAP004900 / 1275705 | VectorBaseID: | AGAP004900 | Length: | 265 | Species: | Anopheles gambiae | 
| Alignment Length: | 265 | Identity: | 77/265 - (29%) | 
|---|---|---|---|
| Similarity: | 118/265 - (44%) | Gaps: | 43/265 - (16%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     2 LIGSCWVLILFARSSNG------IYNGVEAKFDFWTFLASV-WVSGYHECGGAVIDSRIVLTAAQ 59 
  Fly    60 CVKNKPVKRITVRVGTPDIYR--GGRIIRVTALVVHENYKNWD---NDIALLWLEKPVL---SVR 116 
  Fly   117 VTKIPLATKE--PSENEYPSNAGWGEKL-----------LESYVVTRKLQNGV--TKIRPRSMCA 166 
  Fly   167 EELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQG-HGCGFAVLPSLYTNVFHYLEW 230 
  Fly   231 IEENA 235 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG4271 | NP_608665.1 | Tryp_SPc | 19..234 | CDD:238113 | 71/239 (30%) | 
| Tryp_SPc | 19..231 | CDD:214473 | 70/236 (30%) | ||
| AgaP_AGAP004900 | XP_314989.4 | Tryp_SPc | 30..256 | CDD:214473 | 70/237 (30%) | 
| Tryp_SPc | 31..259 | CDD:238113 | 71/239 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||