DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and AgaP_AGAP003807

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_310364.7 Gene:AgaP_AGAP003807 / 1271545 VectorBaseID:AGAP003807 Length:278 Species:Anopheles gambiae


Alignment Length:236 Identity:61/236 - (25%)
Similarity:91/236 - (38%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGG 82
            |.|:..|.:|.....|..  ...:|.|||::|..|.:::|..|........:.|.||:..:..||
Mosquito    57 GGYDATEGQFPHQVSLRR--PPNFHFCGGSIIGPRWIISATHCTIGMEPANLNVYVGSVKLASGG 119

  Fly    83 RIIRVTALVVHENY--KNWDNDIALLWLEKPVLSVRVTK-IPLATKEPSENEYPSNAGWGEKLLE 144
            ...|...:|.|..|  ...:|||:|:...:|::....|: |.||:.........|.:|||    .
Mosquito   120 VYYRTMRIVNHPLYDPNTIENDISLIQTVQPIVFNEHTQPIGLASTNLISATGASISGWG----R 180

  Fly   145 SYVVTRKLQNGVTKIRPRSMCAEE-------------LVEPVGEELLCAFYTENDICPGDYGGPL 196
            |.|:...||.....|.....|..|             :..|.|:          ..|.||.||||
Mosquito   181 SNVILDNLQYMNVNILTMEECRAERPGSGNIFDSVICVSSPFGQ----------GACSGDSGGPL 235

  Fly   197 VLANKVVGIAVQGHGCGFAVLP------SLYTNVFHYLEWI 231
            :....:.|||      .|..:|      .:|..|:.:|.||
Mosquito   236 IYDGMLHGIA------SFVRVPCATEVSDVYERVYSHLSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 60/235 (26%)
Tryp_SPc 19..231 CDD:214473 58/233 (25%)
AgaP_AGAP003807XP_310364.7 Tryp_SPc 54..270 CDD:214473 59/234 (25%)
Tryp_SPc 55..273 CDD:238113 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.