DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4271 and prss56

DIOPT Version :9

Sequence 1:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:231 Identity:70/231 - (30%)
Similarity:101/231 - (43%) Gaps:29/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRI--TVRVGTPDIYR---GGRIIRVTA 89
            |.:|.::..:|...|||.::|...:||||.|.... |..:  ||.||..|:.:   |.:..:|..
 Frog    86 WPWLVNIRFNGELMCGGVLLDDMWILTAAHCFTGS-VNEVLWTVVVGQYDLTKNAQGEKTFQVNR 149

  Fly    90 LVVHE--NYKNWDNDIALLWLEKPVL---SVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVT 149
            :|.|.  |.|.:|||:|||.|...|.   |.|...:|...::|:.......|||| .|.|...::
 Frog   150 IVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAGWG-SLYEDGPLS 213

  Fly   150 RKLQNGVTKIRPRSMCAEELVEPVGEELL-----CAFYTEN--DICPGDYGGPLVLANKV----- 202
            ..:......:..:..|...|    |:.:|     ||.|...  |.|.||.||||...:.:     
 Frog   214 DVIMEARVPVLSQEACRSTL----GKNMLTSTMFCAGYLNGGIDSCQGDSGGPLTCQDPISKQYV 274

  Fly   203 -VGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEK 237
             .||...|.|||....|.:||.|..:.:||.....|
 Frog   275 LYGITSWGDGCGERGKPGVYTRVTAFTDWISHQMNK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 69/226 (31%)
Tryp_SPc 19..231 CDD:214473 67/223 (30%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.