DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and YUH1

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_012633.1 Gene:YUH1 SGDID:S000003860 Length:236 Species:Saccharomyces cerevisiae

Alignment Length:241 Identity:75/242 (31%)
Similarity:113/242 (47%) Gaps:43/242 (18%)


  Fly     6 PLESNPEVLTKYIHKLGVSPAWSVTDVIGL-EDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHD 69
            |:||||||.|.:.||||:...|:..|:..| |.:.|.::||||||.:||||.:|          |
Yeast    10 PIESNPEVFTNFAHKLGLKNEWAYFDIYSLTEPELLAFLPRPVKAIVLLFPINE----------D 64

  Fly    70 RIKEVEEQ--HPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRGVLKDFLEKTASLSPEERGR 132
            |.....:|  ...|:.:.:|...||||..|::||::||:.:......|.:|| |:.|.:...:.|
Yeast    65 RKSSTSQQITSSYDVIWFKQSVKNACGLYAILHSLSNNQSLLEPGSDLDNFL-KSQSDTSSSKNR 128

  Fly   133 -------------ALEKDEKF-TADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRK- 182
                         ..|..:.| |...||......||.        |:|..|.:.|.::|||||. 
Yeast   129 FDDVTTDQFVLNVIKENVQTFSTGQSEAPEATADTNL--------HYITYVEENGGIFELDGRNL 185

  Fly   183 SFPI---KHGPTSEETFVKDAAKVCKEFMARDPNE---VRFTVLAL 222
            |.|:   |..||:.:...::..:|.......:.||   :.|.:|.|
Yeast   186 SGPLYLGKSDPTATDLIEQELVRVRVASYMENANEEDVLNFAMLGL 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 74/240 (31%)
YUH1NP_012633.1 Peptidase_C12 8..231 CDD:324235 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139742505
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 1 1.000 H4377
Inparanoid 1 1.050 96 1.000 Inparanoid score I1470
Isobase 1 0.950 0 Normalized mean entropy S1557
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T1135717
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 LDO PTHR10589
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.