DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and uchl3

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001019576.1 Gene:uchl3 ZFINID:ZDB-GENE-050522-158 Length:230 Species:Danio rerio

Alignment Length:226 Identity:120/227 (53%)
Similarity:160/227 (70%) Gaps:5/227 (2%)


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |.|||:||||:.:::.:||:.|.|...||.|||.:.|..:||||.|.:||||.:|.||..|.||.
Zfish     6 WLPLEANPEVMNQFLRQLGLVPTWQFGDVYGLELEVLSLVPRPVCAVLLLFPITEKYETFRQEEE 70

  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNK---EVDIDRGVLKDFLEKTASLSPEER 130
            .:||...::...|:::|:|...|||||:.|||:||||:   |.::: ..||.||.::|.:||||:
Zfish    71 AKIKGQGQEVSSDVYFMKQTIGNACGTIGLIHAVANNQNHLEFELN-SPLKTFLLQSAKMSPEEK 134

  Fly   131 GRALEKDEKFTADHEALAQEGQTNAAN-HEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEE 194
            ...|||||.....||:.||||||.|.. .|||..||||.||.:|.||||||||.|||.||.|:|:
Zfish   135 AAFLEKDESIRVTHESSAQEGQTEAPGLDEKVDLHFIAFVNVDGHLYELDGRKPFPIVHGKTTED 199

  Fly   195 TFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            ||::|:|:|||:||||||.|:||||:||:.|
Zfish   200 TFLEDSAEVCKKFMARDPQELRFTVVALSKA 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 118/222 (53%)
uchl3NP_001019576.1 Peptidase_C12_UCH_L1_L3 6..227 CDD:187737 118/222 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4377
Inparanoid 1 1.050 235 1.000 Inparanoid score I3306
OMA 1 1.010
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 LDO PTHR10589
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.