DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and uchl3

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001017120.1 Gene:uchl3 XenbaseID:XB-GENE-980858 Length:230 Species:Xenopus tropicalis

Alignment Length:227 Identity:115/228 (50%)
Similarity:158/228 (69%) Gaps:3/228 (1%)


  Fly     2 LTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAE 66
            |.|.|||:||:::.:::.:|||..:|...||.||:.:.|..|||||.|.:||||.:|.||..|||
 Frog     4 LRWLPLEANPDLMNQFLKQLGVGSSWQFVDVYGLDPELLSMIPRPVCAVLLLFPVTEKYETFRAE 68

  Fly    67 EHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDID-RGVLKDFLEKTASLSPEE 129
            |.::||...::....:::|:|...|||||:.|||:||||:| :|.: ...||.|||::.||||||
 Frog    69 EEEKIKSHGQKLDSSVYFMKQTIRNACGTIGLIHTVANNREKLDFECDSALKKFLEESVSLSPEE 133

  Fly   130 RGRALEKDEKFTADHEALAQEGQTNAAN-HEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSE 193
            |.|.|||||.....||..|||||:.|.: .:||..||:|..:.:|.||||||||.||:.||.|:|
 Frog   134 RARFLEKDESIRVTHENTAQEGQSEAPSLDDKVDLHFVAFAHIKGHLYELDGRKPFPVNHGQTTE 198

  Fly   194 ETFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            ||..:||.:||:.||.|||:|:||||:|.:.|
 Frog   199 ETMFEDAIEVCRNFMLRDPDELRFTVIAFSKA 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 113/221 (51%)
uchl3NP_001017120.1 Peptidase_C12_UCH_L1_L3 6..227 CDD:187737 113/221 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 1 1.000 H4377
Inparanoid 1 1.050 232 1.000 Inparanoid score I3220
OMA 1 1.010
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T1058744
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.