DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and Uchl3

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006519309.1 Gene:Uchl3 MGIID:1355274 Length:368 Species:Mus musculus

Alignment Length:330 Identity:117/331 (35%)
Similarity:157/331 (47%) Gaps:108/331 (33%)


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |.|||:||||..:::.:||:.|.|...||.|:|.:.|..:||||.|.:||||.:|.||..|.||.
Mouse    39 WLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE 103

  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPEERG 131
            ::||...:.....:::|:|...|||||:.|||::||||: :..:.| .||.|||::.|:|||||.
Mouse   104 EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERA 168

  Fly   132 RALEKDEKFTADHEALAQEGQTN-------------------------AA--------------- 156
            :.||..:.....||..|.||||.                         ||               
Mouse   169 KFLENYDAIRVTHETSAHEGQTEMKQLPQGEAQPLSPRLSQNLNSGTPAAWSTSSPASQVLGSQS 233

  Fly   157 -------------------------------NH-------------------------------- 158
                                           ||                                
Mouse   234 SSPSSPQPHSSHCRAKASSLCHHASLPWGKRNHVGPAKATSPSLRLRRWRPFLRLPSLGLHSVAP 298

  Fly   159 ---EKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDAAKVCKEFMARDPNEVRFTVL 220
               |||..||||||:.:|.||||||||.|||.||.||:||.::||.:|||:||.|||:|:||..:
Mouse   299 SIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAI 363

  Fly   221 ALTAA 225
            ||:||
Mouse   364 ALSAA 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 114/326 (35%)
Uchl3XP_006519309.1 Peptidase_C12_UCH_L1_L3 39..365 CDD:187737 114/326 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 1 1.000 H4377
Inparanoid 1 1.050 229 1.000 Inparanoid score I3426
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T615714
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 LDO PTHR10589
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
1312.870

Return to query results.
Submit another query.