DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and Uchl3

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017455271.1 Gene:Uchl3 RGDID:1561196 Length:294 Species:Rattus norvegicus

Alignment Length:289 Identity:114/290 (39%)
Similarity:157/290 (54%) Gaps:67/290 (23%)


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |.|||:||||..:::.:||:.|.|...||.|:|.:.|..:||||.|.:||||.:|.||..|.||.
  Rat     6 WLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE 70

  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPEERG 131
            ::||...:.....:::|:|...|||||:.|||::||||: :..:.| .||.|||::.::|||||.
  Rat    71 EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERA 135

  Fly   132 RALEKDEKFTADHEALAQEGQTNAA------------------------------NH-------- 158
            |.||..:.....||..|.||||.::                              ||        
  Rat   136 RHLENYDAIRVTHETSAHEGQTESSSPSSSQPHSSHCRTKASSLCHHASLPWVKRNHVGPAKATS 200

  Fly   159 ---------------------------EKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETF 196
                                       |||..||||:|:.:|.||||||||.|||.||.||:||.
  Rat   201 PSLRLRRWRPFLRLPSLGLHAVAPSIDEKVDLHFIAVVHVDGHLYELDGRKPFPINHGKTSDETL 265

  Fly   197 VKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            ::||.:|||:||.|||:|:||..:||:||
  Rat   266 LEDAIEVCKKFMERDPDELRFNAIALSAA 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 111/285 (39%)
Uchl3XP_017455271.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 1 1.000 H4377
Inparanoid 1 1.050 229 1.000 Inparanoid score I3320
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T617827
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 LDO PTHR10589
Phylome 1 0.910 0.600 Consistency score
TreeFam 1 0.960
1110.830

Return to query results.
Submit another query.