DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and uchl1

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001011321.1 Gene:uchl1 XenbaseID:XB-GENE-1000432 Length:234 Species:Xenopus tropicalis

Alignment Length:213 Identity:92/214 (43%)
Similarity:137/214 (64%) Gaps:8/214 (4%)


  Fly    14 LTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHDRIKEVEEQH 78
            |::.:.:|||...|...||:|.||::|..:..||.|.:||||.:..:|..|   ..:|||::|:.
 Frog    24 LSEVLAQLGVLDGWKFVDVLGFEDESLSNVLTPVCAVLLLFPLTPQHENFR---QSQIKELQEKD 85

  Fly    79 P-EDLFYMRQFTHNACGTVALIHSVANNKEV--DIDRGVLKDFLEKTASLSPEERGRALEKDEKF 140
            . :.:::::|...|:||||.|||:.||||:.  ..:..|||:|:|:||:||||||.:.|||.|..
 Frog    86 ANKKVYFLKQTIGNSCGTVGLIHAAANNKDKLNFAENSVLKNFIEETATLSPEERAKHLEKHEAI 150

  Fly   141 TADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDAAKVCK 205
            .:.|.::|.|||  ...:..|..|||.....:|.|||||||...|::|..|||||.:|||||:|:
 Frog   151 KSAHNSVAAEGQ--CRENSDVNFHFILFTAVDGHLYELDGRLPSPVEHDATSEETLLKDAAKICR 213

  Fly   206 EFMARDPNEVRFTVLALT 223
            :|..|:..||||:.:||:
 Frog   214 QFTEREQGEVRFSAVALS 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 91/211 (43%)
uchl1NP_001011321.1 Peptidase_C12_UCH_L1_L3 24..230 CDD:187737 91/211 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.