DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and calypso

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_611096.1 Gene:calypso FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster

Alignment Length:238 Identity:60/239 (25%)
Similarity:101/239 (42%) Gaps:28/239 (12%)


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKA---FILLFPCSETYEKHR- 64
            |..|||:|.:.|..:...|.... .|.:|..|:        :|:::   ||.||...|.....| 
  Fly    46 WLELESDPGLFTLLLKDFGCHDV-QVEEVYDLQ--------KPIESPYGFIFLFRWIEERRARRK 101

  Fly    65 -AEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRG-VLKDFLEKTASLSP 127
             .|....|...:|:....:|:.:|...|:|.|.||:..:.|..|.::..| .|......|..:||
  Fly   102 IVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQLGDTLSRLKTHTKGMSP 166

  Fly   128 EERGRALEKDEKFTADHEA---------LAQEGQ-TNAANHEKVIHHFIALVNKEGTLYELDGRK 182
            |.:|.|:....:....|.:         |.:.|. .::........||::.|...|.|:||||.|
  Fly   167 ENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFHFVSFVPINGQLFELDGLK 231

  Fly   183 SFPIKHGPTSE-ETFVKDAAKVCKEFM--ARDPNEVRFTVLAL 222
            .:|:.||...: |.:.....:|..|.:  |....::||.::|:
  Fly   232 PYPMNHGGWEDSEDWTDKFRRVMAERLGIATGEQDIRFNLMAV 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 60/237 (25%)
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87739212
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10589
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.