DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and uchl1

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_958885.1 Gene:uchl1 ZFINID:ZDB-GENE-030131-3844 Length:218 Species:Danio rerio

Alignment Length:226 Identity:100/227 (44%)
Similarity:145/227 (64%) Gaps:10/227 (4%)


  Fly     2 LTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAE 66
            :.|.|:|.|||:|.|.:.||||...|...||:||||::|..:|.|..|.:||||.::.:|..|::
Zfish     1 MEWKPMEINPEMLNKVLSKLGVGSKWRFVDVLGLEDESLSGVPSPCCAMMLLFPLTQQHEDFRSK 65

  Fly    67 EHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDID-RGVLKDFLEKTASLSPEE 129
            :       .....:|:::::|...|:||||.|:|:||||:: :|.| ...||.|||.|:.:||.|
Zfish    66 Q-------SVGDCKDVYFLKQTVVNSCGTVGLVHAVANNQDSIDFDNNSALKKFLEATSGMSPAE 123

  Fly   130 RGRALEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEE 194
            |.:.||:::.....|:|:|.|||.. ...:||..|||..||.:|.|||||||...|:.||||..:
Zfish   124 RAKELEQNKAIQETHDAVADEGQCR-PEADKVNFHFITFVNVDGRLYELDGRIDGPVSHGPTKPD 187

  Fly   195 TFVKDAAKVCKEFMARDPNEVRFTVLALTAA 225
            :||.|||:||:|||.|:..||||:.:||..|
Zfish   188 SFVMDAARVCREFMEREKGEVRFSAVALCKA 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 98/220 (45%)
uchl1NP_958885.1 Peptidase_C12_UCH_L1_L3 3..215 CDD:187737 98/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.