DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and Uchl1

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_058933.2 Gene:Uchl1 RGDID:3928 Length:223 Species:Rattus norvegicus

Alignment Length:222 Identity:102/223 (46%)
Similarity:150/223 (67%) Gaps:6/223 (3%)


  Fly     6 PLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHDR 70
            |:|.|||:|.|.:.||||:..|...||:|||::||..:|.|..|.:||||.:..:|..|.::.:.
  Rat     5 PMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEE 69

  Fly    71 IKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPEERGRA 133
            :|. :|..|: :::|:|...|:|||:.|||:||||:: ::.:.| |||.||.:|..||||:|.:.
  Rat    70 LKG-QEVSPK-VYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKC 132

  Fly   134 LEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVK 198
            .||:|...|.|:::|||||...  .:||..|||...|.:|.|||||||..||:.||.:||::.::
  Rat   133 FEKNEAIQAAHDSVAQEGQCRV--DDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQ 195

  Fly   199 DAAKVCKEFMARDPNEVRFTVLALTAA 225
            ||||||:||..|:..||||:.:||..|
  Rat   196 DAAKVCREFTEREQGEVRFSAVALCKA 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 100/218 (46%)
Uchl1NP_058933.2 Peptidase_C12_UCH_L1_L3 5..219 CDD:187737 100/218 (46%)
Interaction with ubiquitin. {ECO:0000250|UniProtKB:P09936} 5..10 3/5 (60%)
Interaction with ubiquitin. {ECO:0000250|UniProtKB:P09936} 211..216 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3320
OMA 1 1.010
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T617827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.