DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch and ubh-3

Sequence 1:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_504653.2 Gene:ubh-3 WormBaseID:WBGene00006723 Length:227 Species:Caenorhabditis elegans

Alignment Length:222 Identity:81/223 (36%)
Similarity:125/223 (56%) Gaps:9/223 (4%)


  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68
            |..||||||.:..::.|:|:: .....||...:|:.|:::|.|..|.||.||.:|..| ..::::
 Worm     9 WQALESNPETINPFLKKIGIT-GLECVDVYSFDDEMLQFVPTPQLALILCFPSAEARE-FLSKQY 71

  Fly    69 DRIKEVEEQHPEDLFYMRQFTH--NACGTVALIHSVAN-NKEVDIDRGVLKDFLEKTASLSPEER 130
            :.:::..|: ||.:|:|.|...  |||||.||.||:|| ...|::.:|....:.||...::.:||
 Worm    72 EEVEKNGEK-PEGVFFMNQSEEIGNACGTFALFHSLANLENRVNLGKGKFAKWYEKAKLVNEDER 135

  Fly   131 GRALEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEET 195
            ...|..|......||..|:||:|..::|  |.:|||..|||.|.|||:|....||...|.|::.|
 Worm   136 SDLLSGDTDLAEAHEETAEEGETEQSDH--VDYHFITYVNKNGQLYEIDSCAPFPRPLGATTDST 198

  Fly   196 FVKDAAKVCKEFMARDPNEVRFTVLAL 222
            .:|||:...||.|....| :.|:.:||
 Worm   199 MIKDASTAIKELMNNVKN-LSFSAMAL 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 80/221 (36%)
ubh-3NP_504653.2 Peptidase_C12_UCH_L1_L3 9..224 CDD:187737 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87739062
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I3057
Isobase 1 0.950 0 Normalized mean entropy S1557
OMA 1 1.010
OrthoDB 1 1.010 D1013351at2759
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T374602
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.779 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.