DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and DUR3

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_011847.1 Gene:DUR3 SGDID:S000001008 Length:735 Species:Saccharomyces cerevisiae

Alignment Length:593 Identity:119/594 (20%)
Similarity:202/594 (34%) Gaps:179/594 (30%)


  Fly    62 DYMMGSRNLRVFPVGMSLIASCISAVAIIGTPSEI--------YNYGTQYCFIVIALVLQGLAVS 118
            ::....|:::...|..::::|.|....::.:.::.        |.|....||.:||..:      
Yeast    47 EFTTAGRSVKTGLVAAAVVSSWIWCSTLLTSSTKEYADGIFGGYAYAAGACFQIIAFAI------ 105

  Fly   119 YIYLPVFSALQVTSSYEYLEM---RFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNM 180
               |.:.:.....:::.|||:   |:............|...:|....|....:...:.::|||.
Yeast   106 ---LAIKTKQMAPNAHTYLELVRTRYGKIGHGCYLFYAIATNILVTSMLLTSGSAVFSDLTGMNT 167

  Fly   181 YLIEAFIIVI-CVIYTVLGGLKAVVHTDIWQ--VVIMFASVLTIVVLATCYIDDQADFLEGLVRG 242
             :...|::.: .|:||:.||:||...||...  |:|:...|....|.||..:......:..||| 
Yeast   168 -IASCFLLPVGVVVYTLFGGIKATFLTDYMHTCVIIIIVLVFAFKVYATSDVLGSPGKVYDLVR- 230

  Fly   243 GRLIFSETNPSPFARHTVWSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKM-------------A 294
                      ....||.|.....|.....||.:|....:::...:..|:.:             |
Yeast   231 ----------EAAKRHPVDGNYQGEYMTMTSKSAGILLIINLIGNFGTVFLDNGYWNKAISASPA 285

  Fly   295 RASIAFLVVGAAFF-----ISLLCYLGLLI------FHAYRDCDPLSAGLIMNDDQLVPLFVVNS 348
            .:..|:.:.|.|:|     |||...|..|.      |..|.  |||::            |..||
Yeast   286 ASLKAYAIGGLAWFAVPSLISLTMGLACLAVETSPNFPTYP--DPLTS------------FQANS 336

  Fly   349 LGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKMELGEWASTIVVKGSIVVLGL 413
             |.|.....:.|.|..||..|.|.:::..||.:..:                            |
Yeast   337 -GLVLPAAAIAIMGKGGAVASLLMIFMAVTSAMSAE----------------------------L 372

  Fly   414 LAFAMVFVLE--------KVSGVLSISVSLAAIAASSTFGIFTVGMLVPWANTVGTAVGGIASVL 470
            :|.:.||..:        :.||...|..|..|.       ||           .|.|:.|.:..|
Yeast   373 IAVSSVFTYDIYREYIDPRASGKKLIYTSHVAC-------IF-----------FGLAMSGFSVGL 419

  Fly   471 LTGWISFGSQFAAASGQLGSQRLPVSVEGC-------------LANASVAENAWVAEEEVFPLYR 522
            ..|.||.|..:......:.|..|||.:..|             :....:|..:|:...:  .||:
Yeast   420 YYGGISMGYIYEMMGIIISSAVLPVVLTLCSKDMNLVAAVVSPILGTGLAIMSWLVCTK--SLYK 482

  Fly   523 LSYHWISPIGVLTV--------VVVGSLVSLVTKPTDIKSLDSDLITPVIHRFLP--KECFEQGN 577
                      .|||        ::.|:||:              |::|.|  |:|  ...|:..|
Yeast   483 ----------ELTVDTTFMDYPMLTGNLVA--------------LLSPAI--FIPILTYVFKPQN 521

  Fly   578 AEENSVKD 585
            .:...:||
Yeast   522 FDWEKMKD 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 104/528 (20%)
DUR3NP_011847.1 SLC5sbd_DUR3 14..517 CDD:271370 115/580 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1730
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.