DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and Slc5a4b

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_075708.2 Gene:Slc5a4b MGIID:1890478 Length:660 Species:Mus musculus

Alignment Length:623 Identity:136/624 (22%)
Similarity:242/624 (39%) Gaps:128/624 (21%)


  Fly    10 DYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRNLRVFP 74
            |.:|.:...|:.:|:||: ..:|.:|.                      .:..:.:...::..:|
Mouse    28 DISVIVIYFIVVLAVGLW-SMVRSNRG----------------------TVGGFFLAGHDMAWWP 69

  Fly    75 VGMSLIASCISA---VAIIGT--PSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQVTSSY 134
            :|.||.||.|.:   |.:.||  .|.|.....::..:::.|||     .:::||::....|.:..
Mouse    70 MGASLFASNIGSNHFVGLAGTGAASGIAIAAVEWNALLMVLVL-----GWVFLPIYIKAGVLTMP 129

  Fly   135 EYLEMRFHSAIRSI---VSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYTV 196
            |||..||......|   |..:||: |.|....:.:..|:.:....|:|:||....::.|...|||
Mouse   130 EYLRKRFGGKRLQIYLSVLSLFIM-VALQTSSIIFSGAIFIQLALGLNLYLAVFILLAITAFYTV 193

  Fly   197 LGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLE-------GLVRGGRLIFSET--NP 252
            .|||.:|::||..|..||....|.::..|...:.....|.|       .:|.|..|..|..  .|
Mouse   194 AGGLASVIYTDSVQTFIMLLGSLILMGFAFAEVGGYESFTEKYMNAIPSVVEGDNLTISPKCYTP 258

  Fly   253 SPFARHTV---------W-SVVIGNT----FYWTSLNAVHQTVVHRYMSLPTLKMARASI----- 298
            .|.:.|..         | .::.|.|    :||    ...|.:|.|.:....:...:|:.     
Mouse   259 QPDSFHVFRDPVTGDIPWPGLIFGMTILAIWYW----CADQVIVQRCLCGKNMSHVKAACILCGY 319

  Fly   299 -----AFLVVGAAFFISLLCYLGLLIFHAYRDCDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGL 358
                 .||:|... .||.:.|...:......:|:......:...:...|..|:..:..  |:.||
Mouse   320 LKLLPMFLMVMPG-MISRILYTDKVACVVPSECEKQCGTAVGCTNYAYPTLVLELMPD--GLRGL 381

  Fly   359 FIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKMELGEWASTIVVKGSIVVLGLLAFAMVFV-L 422
            .::.:..:.:|||:...||.|.:...||..   |:........:::.|.|..:.|:|.::::| |
Mouse   382 MLSVMLASLMSSLTSIFNSASTLFTIDLYT---KIRKKASERELMIAGRIFGMVLIAVSILWVPL 443

  Fly   423 EKVS--GVLSISVSLAAIAASSTFG-----IFTVGMLVPWANTVGTAVGGIASVLLTGWISFGSQ 480
            .:||  |.|...:.    :.||..|     :|.:.:.....|..| |..|:...|:.|.|...::
Mouse   444 VQVSQNGQLFHYIG----SVSSYLGPPLGAVFMLAIFFKRVNEQG-AFWGLMVGLVVGLIRLIAE 503

  Fly   481 FAAASGQLGSQRLPVSVEGCLANASVAENAWVAEEEVFPLYRLSYHWISPIGVLTVVVVGSLVSL 545
            |...:|            .|:|.::.        .::.......|..|....|..:|::|  ||.
Mouse   504 FVYGTG------------SCVAPSNC--------PKIICGVHYMYFAIILFFVSIIVILG--VSF 546

  Fly   546 VTKPTDIKSLDSDLITPVIHRFLPKECFEQGNAEENSV 583
            :|:|           .|.:|  |.:.|:...|..|..:
Mouse   547 LTEP-----------IPDVH--LYRLCWSLWNNTEERI 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 123/570 (22%)
Slc5a4bNP_075708.2 SLC5-6-like_sbd 27..660 CDD:294310 136/624 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110725091
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.