DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and Slc5a8

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001178916.1 Gene:Slc5a8 RGDID:1564146 Length:611 Species:Rattus norvegicus

Alignment Length:580 Identity:197/581 (34%)
Similarity:318/581 (55%) Gaps:70/581 (12%)


  Fly     1 MDTYR----FGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMN 61
            ||..|    |...||.||.|:.::|.|||:|:.|   :..|.:|:                   .
  Rat     1 MDASRDIGSFVVWDYVVFAGMLLISAAIGIYYAF---AGGGQQTS-------------------K 43

  Fly    62 DYMMGSRNLRVFPVGMSLIASCISAVAIIGTPSEIYN-------YGTQYCFIVIALVLQGLAVSY 119
            |::||.|::...||.:||.||.:|||.::|||:|:|.       :|..|.|:|:       ..:.
  Rat    44 DFLMGGRSMSAVPVALSLTASFMSAVTVLGTPAEVYRFGAIFSIFGVTYFFVVV-------ISAE 101

  Fly   120 IYLPVFSALQVTSSYEYLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIE 184
            ::||||..|.:||:|||||:||:..||...:::||:..:||...:.|.||||||||:|.:::...
  Rat   102 VFLPVFYRLGITSTYEYLELRFNRFIRLCGTVLFIVQTILYTGIVIYAPALALNQVTGFDLWGAV 166

  Fly   185 AFIIVICVIYTVLGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSE 249
            ....|:|..|..||||||||.||::||.||.|...::::.|:.........|.....||||.|..
  Rat   167 VATGVVCTFYCTLGGLKAVVWTDVFQVGIMVAGFASVIIQASITQGGINTILSDASNGGRLNFWN 231

  Fly   250 TNPSPFARHTVWSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLC- 313
            .||:|..|||.|::::|.||.||::..|:|:.|.||:|..:...|:.|:...:||  .::.|:| 
  Rat   232 FNPNPLQRHTFWTIIVGGTFTWTTIYGVNQSQVQRYISCKSRLHAKLSLYVNLVG--LWVILICS 294

  Fly   314 -YLGLLIFHAYRDCDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNS 377
             :.||.::..|.||||.::..:...|||:|..|::.|.:..|:||||:|..:..:||::|..:|:
  Rat   295 VFCGLALYSRYHDCDPWTSKKVSEVDQLMPYLVLDILKNYPGVPGLFVACAYSGTLSTVSSSINA 359

  Fly   378 TSLVILQDLVRGCFKMELGEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASS 442
            .:.|.::||::..|| .|.|.:.:.:.:|..|:.|.|...|..|...:..:|..::|:..:....
  Rat   360 LAAVTVEDLIKPRFK-SLSEKSLSWISQGMSVLYGALCIGMAAVASLMGALLQAALSIFGMVGGP 423

  Fly   443 TFGIFTVGMLVPWANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSVE--GCLANAS 505
            ..|:|::|:|||:||:||...|.:|...::.|:..|:|...   .|..:.||:|:|  ||  |::
  Rat   424 LLGLFSLGILVPFANSVGAFAGLLAGFAVSLWVGIGAQLYP---PLPERTLPLSLETHGC--NST 483

  Fly   506 VAENAWVAEEEV------FPL------------YRLSYHWISPIGVLTVVVVGSLVSLVT 547
            .....|::..|:      |.:            |.|||.:.|.||.||.::||.|:||.|
  Rat   484 HNGTDWMSTTEMPFSTSAFQIHDVERSALMDNWYSLSYLYFSTIGTLTTLLVGILISLAT 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 183/551 (33%)
Slc5a8NP_001178916.1 SLC5sbd_SMCT1 7..549 CDD:271402 194/575 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109770844
eggNOG 1 0.900 E1_COG0591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42985
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.