DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and slc5a8

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001351880.1 Gene:slc5a8 XenbaseID:XB-GENE-479634 Length:620 Species:Xenopus tropicalis

Alignment Length:621 Identity:190/622 (31%)
Similarity:322/622 (52%) Gaps:70/622 (11%)


  Fly     6 FGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRNL 70
            |...||.||..:.::|..||:|:.|   :..|.||:                   .|::||.|::
 Frog    10 FTVWDYVVFALMLLISAVIGIYYAF---AGGGQKTS-------------------KDFLMGGRSM 52

  Fly    71 RVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQVTSSYE 135
            ...||.:||.||.:|||.::|||:|:|.:|:.:........:..:..|.::||||..|.:||:||
 Frog    53 TAVPVALSLTASFMSAVTVLGTPAEVYRFGSMFSIFAFTYAIVVVISSEVFLPVFYRLGITSTYE 117

  Fly   136 YLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYTVLGGL 200
            |||:||:..:|.:.:|:||:..|||...:.|.||||||||:|.:::.......|:|..|..:|||
 Frog   118 YLELRFNKFVRLLGTILFIIQTVLYTGIVIYAPALALNQVTGFDLWGAVVATGVVCTFYCTMGGL 182

  Fly   201 KAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTVWSVVI 265
            ||||.||::||.||.|...::::.|..........|.....|.||.|.:..|:|..||:.|::|:
 Frog   183 KAVVWTDVFQVGIMVAGFSSVIIRAVVVQGGIGPILNDSYYGDRLNFWDFTPNPLQRHSFWTIVV 247

  Fly   266 GNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLCYLGLLIFHAYRDCDPLS 330
            |.||.||.:..|:|:.|.||::..|...|:.|:...::|....::.....||.::..|:||||.:
 Frog   248 GGTFTWTGIYGVNQSQVQRYIACKTRFQAKLSLYINLLGLWAILACAVLSGLAMYSIYKDCDPWT 312

  Fly   331 AGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKMEL 395
            |..:...|||:|...::.|....|:||||::..:..:||::|..:|:.:.|.::||::..|: .|
 Frog   313 AQFVSAPDQLMPYLSLDILRDYPGLPGLFVSCAYSGTLSTVSSSINALAAVTVEDLIKPYFR-SL 376

  Fly   396 GEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTVGMLVPWANTVG 460
            .|...:.:.||:.::.|.:..||..:...:.|:|..::|:..:......|:|.:|::.|:.|::|
 Frog   377 SETKMSWISKGTSLIYGAICIAMAGLASLMGGLLQAALSIFGMVGGPLLGLFALGIIFPFVNSLG 441

  Fly   461 TAVGGIASVLLTGWISFGSQF--AAASGQLGSQRLPVSVEGCLANASVAENAWVAEEEVFPL--- 520
            ..:|.::...::.|:..|||.  ..||..|..   |:|:|||  |.:..|:.|..  .|.|:   
 Frog   442 AVIGLLSGFAISLWVGIGSQIYPPTASSSLPK---PLSLEGC--NFTSFESNWTT--TVMPMMTT 499

  Fly   521 ---------------YRLSYHWISPIGVLTVVVVGSLVSLVTKPTDIKSLDSD-LITPVIHRFLP 569
                           |.|||.:.|.:|.:..||||.:.||::.... ::::.| |:|.....:|.
 Frog   500 LIPEVSSRPELADSWYSLSYLYFSTLGTIVAVVVGVIASLLSGGLK-QNVNRDFLLTSQDFSYLN 563

  Fly   570 ---KECFEQGNAEENSV---------------KDNP 587
               ..|.::|..|:..|               .|||
 Frog   564 VLFSNCKKKGQEEKVEVLNWKMRSTDTDMDQGTDNP 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 171/542 (32%)
slc5a8NP_001351880.1 SLC5sbd_SMCT1 7..547 CDD:271402 179/568 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109769658
eggNOG 1 0.900 E1_COG0591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.