DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and CG31262

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001138069.2 Gene:CG31262 FlyBaseID:FBgn0051262 Length:579 Species:Drosophila melanogaster

Alignment Length:582 Identity:329/583 (56%)
Similarity:445/583 (76%) Gaps:9/583 (2%)


  Fly     1 MDTYRFGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMM 65
            ||.||||||||.|.:.:|:||...|:|||.::|.....|:.:..|     |..||||:|:::|:|
  Fly     1 MDNYRFGTVDYLVLVAMTLLSTGTGIYFGALKKKHKNKKSVSEDN-----RRTNFGSEKIDEYLM 60

  Fly    66 GSRNLRVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQV 130
            ||||::|.||.::|    ....:|||||||||:|||||..|::|::|||:|.||:||||:||||:
  Fly    61 GSRNMKVIPVSITL----YRVTSIIGTPSEIYHYGTQYYLIIVAIILQGIAFSYVYLPVYSALQI 121

  Fly   131 TSSYEYLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYT 195
            .|:||||.:||:|.||:..|.:::..::.||||:.|:|||:|:||||:|.:||...||:.||.||
  Fly   122 GSAYEYLGLRFNSIIRTTASFMYVFGILTYLPFIVYVPALSLSQVSGLNTHLIGLVIILACVTYT 186

  Fly   196 VLGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTV 260
            .:||||||||||:|||.:||.|::.:..||..|.:......:...:||||:.:.|||||:.||||
  Fly   187 FMGGLKAVVHTDVWQVAVMFLSLVAVAFLAIYYSNGLVAVFDDAEQGGRLMLANTNPSPYVRHTV 251

  Fly   261 WSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLCYLGLLIFHAYRD 325
            |||:||...:|||:||..|.:|.||||||:||.:|.:.....:|.:.||:|.|::|||:|..|:|
  Fly   252 WSVLIGGFSFWTSVNAGGQHMVQRYMSLPSLKKSRQASFIFTIGVSIFIALCCFMGLLLFSKYKD 316

  Fly   326 CDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGC 390
            |||.|||:|:|||||:|||||.|:||:||||||||||||||.|||||...|:.|:|.|:|:|||.
  Fly   317 CDPRSAGMILNDDQLLPLFVVQSVGHIYGMPGLFIAGIFGAGLSSLSSCFNTVSMVFLEDIVRGF 381

  Fly   391 FKMELGEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTVGMLVPW 455
            ||||..|..|||::|..|:..|:|||.:||:|:.:.|:||:..|:::|.|.::||:||:|||.||
  Fly   382 FKMEPSERQSTILIKTCIIFQGILAFLIVFLLQHLRGILSVCNSISSITAGTSFGVFTLGMLFPW 446

  Fly   456 ANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSVEGCLANASVAENAWVAEEEVFPL 520
            |||:||||||::||||.||||||||.|||||||.|..|||||:.|:.|.::.|:.||.:::||||
  Fly   447 ANTIGTAVGGLSSVLLAGWISFGSQIAAASGQLKSGMLPVSVKECVGNVTLPEDPWVDQDQVFPL 511

  Fly   521 YRLSYHWISPIGVLTVVVVGSLVSLVTKPTDIKSLDSDLITPVIHRFLPKECFEQGNAEENS 582
            |||||||:|||||:|.||||:||||:|||.|||:|.::||:||||||||:|||...|..|.:
  Fly   512 YRLSYHWVSPIGVVTAVVVGALVSLITKPADIKTLHAELISPVIHRFLPRECFRGRNLNERT 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 288/522 (55%)
CG31262NP_001138069.2 SLC5sbd_NIS-SMVT 9..522 CDD:271383 288/522 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130811496
eggNOG 1 0.900 E1_COG0591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1730
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 1 1.000 FOG0000185
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42985
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.