DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and CG9657

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001284983.1 Gene:CG9657 FlyBaseID:FBgn0029950 Length:601 Species:Drosophila melanogaster

Alignment Length:591 Identity:208/592 (35%)
Similarity:346/592 (58%) Gaps:19/592 (3%)


  Fly     6 FGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRNL 70
            ||..||.||..:..:...||:||....:..:..:....:.||         :.....|::|.|.:
  Fly    13 FGWPDYLVFCLMLAICAVIGIYFCLQLRLESRKQKANGSEEA---------ASSAASYLVGGRQM 68

  Fly    71 RVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQVTSSYE 135
            ::||:.||||:|.||.:.::|||:|:|.||.||.:|:.:|||.|..:.|.:||||..|.:.|:|:
  Fly    69 KIFPITMSLISSFISGITLLGTPTEVYLYGAQYMYIMGSLVLMGFCMYYFFLPVFHELNLISTYK 133

  Fly   136 YLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYTVLGGL 200
            |||.|::.::|...|::||:..:|:||.:.|:||:|.||.:|:|::::...:.|:|:.||.:|||
  Fly   134 YLEQRYNRSLRLFGSVMFIVASLLWLPIVIYVPAIAFNQATGVNIHIVTPIVCVVCIFYTCIGGL 198

  Fly   201 KAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTVWSVVI 265
            ||||.||:.|.:|||.::..:::..|..|.......:......||.....:.....|:|.:|:|:
  Fly   199 KAVVWTDVIQTLIMFGAMALVLIKGTLDIGGPGVVWQKAQETARLEVPNFSADLSERYTFYSLVL 263

  Fly   266 GNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLCYLGLLIFHAYRDCDPLS 330
            |...:|...||:.|.::.||:|||||:.||.:|...:.|...|:.:..|.||||:..|..||||.
  Fly   264 GGVAHWLKSNAISQNMIQRYLSLPTLRDARIAIWTFIAGVLAFLMICGYTGLLIYATYSQCDPLE 328

  Fly   331 AGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKMEL 395
            ..|...:|||:||.|:::||...|:||:|:||:|.|:|||||..|||.|.|:|:|.|:...|..|
  Fly   329 TKLAQRNDQLLPLLVMDTLGSYPGLPGVFVAGVFSAALSSLSTGLNSLSAVVLEDFVKTFRKSPL 393

  Fly   396 GEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTVGMLVPWANTVG 460
            .|..:..|::..:||.|::..|:||.:||:..||.::::|:::|.....||||.|:::||.|:.|
  Fly   394 TEGQTAFVMRSVVVVFGIIFVALVFAVEKLGAVLQLTITLSSVANGPLLGIFTAGVMLPWVNSKG 458

  Fly   461 TAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSVEGCLAN--------ASVAENAWVAE--E 515
            ..:||.:|:::..|:...:|....:|.|..:|.|.|..||...        ||:|.:..::.  .
  Fly   459 ALLGGFSSLIVMAWMCVSAQRDLVTGDLVYKRKPYSTMGCNYTFAGEPREFASLALDGAISSVPS 523

  Fly   516 EVFPLYRLSYHWISPIGVLTVVVVGSLVSLVTKPTDIKSLDSDLITPVIHRFLPKECFEQGNAEE 580
            ..|.|||:||.:.:..|.|..:||..:.||:.:.||:..:|:.|:||.:.|:|.:....:....:
  Fly   524 APFQLYRISYLYFTLFGALVTIVVALVTSLLLRETDLDGVDTRLLTPFVRRWLERRRHRRSKIPD 588

  Fly   581 NSVKDN 586
            :..|.:
  Fly   589 SGQKSS 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 191/532 (36%)
CG9657NP_001284983.1 SLC5sbd_NIS-SMVT 16..554 CDD:271383 197/547 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110604638
eggNOG 1 0.900 E1_COG0591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I1928
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42985
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.