DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and Slc5a8

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_663398.2 Gene:Slc5a8 MGIID:2384916 Length:611 Species:Mus musculus

Alignment Length:573 Identity:194/574 (34%)
Similarity:313/574 (55%) Gaps:56/574 (10%)


  Fly     1 MDTYR----FGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMN 61
            ||..|    |...||.||.|:.::|.|||:|:.|   :..|.:|:                   .
Mouse     1 MDASRDIGSFVVWDYVVFAGMLLISAAIGIYYAF---AGGGQQTS-------------------K 43

  Fly    62 DYMMGSRNLRVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFS 126
            |::||.|::...||.:||.||.:|||.::|||:|:|.:|..:...||......:..:.::||||.
Mouse    44 DFLMGGRSMSAVPVALSLTASFMSAVTVLGTPAEVYRFGAIFSIFVITYFFVVVISAEVFLPVFY 108

  Fly   127 ALQVTSSYEYLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVIC 191
            .|.:||:|||||:||:..||...:|:||:..:||...:.|.||||||||:|.:::.......|:|
Mouse   109 RLGITSTYEYLELRFNRCIRLCGTILFIVQTILYTGIVIYAPALALNQVTGFDLWGAVVATGVVC 173

  Fly   192 VIYTVLGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFA 256
            ..|..||||||||.||::||.||.|...::::.|:.........|.....||||.|...:|:|..
Mouse   174 TFYCTLGGLKAVVWTDVFQVGIMVAGFASVIIQASITQHGINKILSDAFNGGRLNFWNFDPNPLQ 238

  Fly   257 RHTVWSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLCYLGLLIFH 321
            |||.|::|||.||.||::..|:|:.|.||:|..:...|:.|:...:||....::...:.||.::.
Mouse   239 RHTFWTIVIGGTFTWTTIYGVNQSQVQRYISCKSRLHAKLSLYVNLVGLWVILTCSIFCGLALYS 303

  Fly   322 AYRDCDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDL 386
            .||:|||.::..:...|||:|..|::.|.:..|:||||:|..:..:||::|..:|:.:.|.::||
Mouse   304 RYRECDPWTSKKVSAIDQLMPYLVLDILKNYPGVPGLFVACAYSGTLSTVSSSINALAAVTVEDL 368

  Fly   387 VRGCFKMELGEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTVGM 451
            ::..|| .|.|.:.:.:.:|..|:.|.|...|..:...:..:|..::|:..:......|:|::|:
Mouse   369 IKPRFK-SLSEKSLSWISQGMSVLYGALCIGMAALASLMGALLQAALSIFGMVGGPLLGLFSLGI 432

  Fly   452 LVPWANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSVE--GCLANASVAENA--WV 512
            |||:||::|...|.:|...::.|:..|:|...   .|..:.||:.:|  ||    ::..|.  |:
Mouse   433 LVPFANSIGALTGLLAGFAISLWVGIGAQLYP---PLPERTLPLPLETYGC----NITHNGSDWM 490

  Fly   513 AEEEV--------------FPL----YRLSYHWISPIGVLTVVVVGSLVSLVT 547
            :..|:              .||    |.|||.:.|.||.||.:.||.|:||.|
Mouse   491 STTEMPFSTSAFQIHNAERTPLMDNWYSLSYLYFSTIGTLTTLFVGILISLST 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 180/544 (33%)
Slc5a8NP_663398.2 SLC5sbd_SMCT1 7..549 CDD:271402 191/568 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109770255
eggNOG 1 0.900 E1_COG0591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.