DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and ZK822.5

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001041067.1 Gene:ZK822.5 WormBaseID:WBGene00014092 Length:577 Species:Caenorhabditis elegans

Alignment Length:559 Identity:142/560 (25%)
Similarity:266/560 (48%) Gaps:51/560 (9%)


  Fly     9 VDYAVFLGVTI-LSIAIGLYFGFIRKS----RNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSR 68
            :|||:| |::| ||::.|:|...  ||    |.|.:|.                  ..:|:||.|
 Worm    10 LDYAIF-GLSIGLSLSTGVYHAI--KSRIILRRGDRTA------------------KEEYLMGGR 53

  Fly    69 NLRVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQVTSS 133
            .|...||.:||:.:.:|.:.::|.|:|::..|.|.....:..|...:...:::||||..::.|..
 Worm    54 QLPPLPVALSLLTTFLSGILMLGVPAEMFQRGAQIWLNFVIGVASSIVTCFVFLPVFHKMKSTCL 118

  Fly   134 YEYLEMRFHS-AIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYTVL 197
            :||...|::| .||.:.|::|:|..::|:..:.|.|::||:.|..:|.:.:.........:||.|
 Worm   119 HEYFIHRYNSILIRRLFSLLFLLFTIVYMSVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCL 183

  Fly   198 GGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFAR----- 257
            |||||||.||..|.|||:..|.|::     |.......:.||.|...:.:.....|...|     
 Worm   184 GGLKAVVWTDSLQAVIMYTGVFTLI-----YKGLSHPRVGGLERVLSIAWDSGRISELGRMDWRI 243

  Fly   258 ---HTVWSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLCYLGLLI 319
               :::|..:...|..|.:...|:|..:.||.|||:||:|::.|.:.:.......|::.::|.:.
 Worm   244 DQYNSLWINLFSGTIVWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIA 308

  Fly   320 FHAYRDCDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQ 384
            ...:.:|:||..|.:...|.:...|..:.|....|:.||:::.|..|:||:||..:||.:..|.:
 Worm   309 LAYFYNCNPLETGEVKESDHITISFARDILQPTPGLFGLYVSCIMSATLSTLSSGMNSMAAAIYE 373

  Fly   385 DLVRGCFKMELGEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTV 449
            |.::.....::.:..:|.:.|..:::.||.:..:.|:.|.:.|.|.|.:|:....:.....||.:
 Worm   374 DFLKNSLDGKITDTGATRLNKIIVLICGLSSTGLAFLAEVLGGSLRICISVMGAMSGPMVAIFVL 438

  Fly   450 GMLVPWANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLP--VSVEGCLANASV------ 506
            .:..|.:.:....:....|.|....|...:........|   .||  .::|||..|::.      
 Worm   439 ALFFPKSGSKSCLISFFLSNLFCLIICIANYIQDPYHDL---FLPTNTTLEGCNGNSNFTIRMMP 500

  Fly   507 AENAWVAEEEVFPLYRLSYHWISPIGVLTVVVVGSLVSL 545
            ..:|.....:...:.|:|.:..:.:|.:.::::|.:.||
 Worm   501 TYDAHYGNPDTLYISRISTYSYAGVGFVLMIIIGWIASL 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 138/544 (25%)
ZK822.5NP_001041067.1 SLC5sbd_NIS-SMVT 11..540 CDD:271383 142/559 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109617895
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I1928
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 1 1.000 T375294
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42985
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.