DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and SLC5A12

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_848593.2 Gene:SLC5A12 HGNCID:28750 Length:618 Species:Homo sapiens

Alignment Length:620 Identity:190/621 (31%)
Similarity:320/621 (52%) Gaps:78/621 (13%)


  Fly     1 MDTYRFGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMM 65
            |:...|...||.||..:..:|..||::|..  |.|.  |.|:                  .::::
Human     1 MEVKNFAVWDYVVFAALFFISSGIGVFFAI--KERK--KATS------------------REFLV 43

  Fly    66 GSRNLRVFPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIALVLQGLAVSYIYLPVFSALQV 130
            |.|.:...|||:||.||.:|||.::|||||:|.:|..:....||.:...|..|.::||||....:
Human    44 GGRQMSFGPVGLSLTASFMSAVTVLGTPSEVYRFGASFLVFFIAYLFVILLTSELFLPVFYRSGI 108

  Fly   131 TSSYEYLEMRFHSAIRSIVSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIYT 195
            ||:||||::||:..:|...::|:|:..:||...:.|.||||||||:|.:::.......::|..|.
Human   109 TSTYEYLQLRFNKPVRYAATVIYIVQTILYTGVVVYAPALALNQVTGFDLWGSVFATGIVCTFYC 173

  Fly   196 VLGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTV 260
            .||||||||.||.:|:|:|....||:::..:.:.....:.||....|.||...:.:..|..|||.
Human   174 TLGGLKAVVWTDAFQMVVMIVGFLTVLIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTF 238

  Fly   261 WSVVIGNTFYWTSLNAVHQTVVHRYMSLPTLKMARASIAFLVVGAAFFISLLC--YLGLLIFHAY 323
            |::.:|.||.|..:..|:|:.:.|.:|..|.|.|:.::.|.::|  .:|.|:|  :.||:::..:
Human   239 WTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNLLG--LWIILVCAVFSGLIMYSHF 301

  Fly   324 RDCDPLSAGLIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVR 388
            :||||.::|:|...|||:|.||:.....:.|:||||:|..|..:||:::..:|:.:.|..:|.|:
Human   302 KDCDPWTSGIISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVASSINALATVTFEDFVK 366

  Fly   389 GCFKMELGEWASTIVVKGSIVVLGLLAFAMVFVLEKVSGVLSISVSLAAIAASSTFGIFTVGMLV 453
            .||. .|.:..||.:.||..::.|::..:|......:.||:..|:|:..:......|:|::|::.
Human   367 SCFP-HLSDKLSTWISKGLCLLFGVMCTSMAVAASVMGGVVQASLSIHGMCGGPMLGLFSLGIVF 430

  Fly   454 PWANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSVEGCLANASVA----------- 507
            |:.|..|...|.:..:.|:.|::.|: |...:....:..||:|.:.|:.:...|           
Human   431 PFVNWKGALGGLLTGITLSFWVAIGA-FIYPAPASKTWPLPLSTDQCIKSNVTATGPPVLSSRPG 494

  Fly   508 -ENAWVAEEEVFPLYRLSYHWISPIGVLTVVVVGSLVSLVT---KPTDIKSLDSDLITPVIHRFL 568
             .:.|         |.:||.:.|.:|.|..:|.|.::||:|   :..||:.|   ||.||.:.| 
Human   495 IADTW---------YSISYLYYSAVGCLGCIVAGVIISLITGRQRGEDIQPL---LIRPVCNLF- 546

  Fly   569 PKECF-------------------EQGNAEENSVK 584
               ||                   ||.|.|..|.:
Human   547 ---CFWSKKYKTLCWCGVQHDSGTEQENLENGSAR 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 166/536 (31%)
SLC5A12NP_848593.2 SLC5sbd_SMCT2 3..527 CDD:212089 174/559 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110571995
eggNOG 1 0.900 E1_COG0591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D489472at33208
OrthoFinder 1 1.000 FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR42985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.