DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and slc5a9

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002931459.1 Gene:slc5a9 XenbaseID:XB-GENE-940879 Length:679 Species:Xenopus tropicalis

Alignment Length:645 Identity:144/646 (22%)
Similarity:247/646 (38%) Gaps:160/646 (25%)


  Fly     5 RFGTVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRN 69
            :||..|..|.:...:..:.:|:: ..||.||.                      .:..|.:..|:
 Frog    16 KFGVPDIIVVVVYFVFVLGVGIW-SSIRASRG----------------------TVGGYFLAGRS 57

  Fly    70 LRVFPVGMSLIASCISAVAIIGTPSE-------IYNYGTQYCFIVIALVLQGLAVSYIYLPVFSA 127
            :..:|:|.||::|.:.:...||....       :..:.....::::||       .:|::||:.|
 Frog    58 MTWWPIGASLMSSNVGSGLFIGLAGSAAAGGLAVGGFEWNASWVLVAL-------GWIFVPVYIA 115

  Fly   128 LQVTSSYEYLEMRF-HSAIRSIVSIIFILDVVLYLPFL-----AYLPALALNQVSGMNMYLIEAF 186
            ..|.:..|||:.|| ...||..:|   :|.::||: |.     .|..||.:....|.|:||....
 Frog   116 SGVVTMPEYLKKRFGGKRIRIYIS---VLSLILYI-FTKISTDIYSGALFIQVSLGWNIYLSTVI 176

  Fly   187 IIVICVIYTVLGGLKAVVHTDIWQVVIMFASVLTIVVLA-------------------------- 225
            ::.:..|||:.|||.||::||..|.|||.|....::.::                          
 Frog   177 LLAVTAIYTIAGGLTAVIYTDTLQTVIMVAGAFVLMFISFEKIGWYPGLEQKYMEAIPKITVANT 241

  Fly   226 TCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTVW-SVVIGNTFYWTSLNAVHQTVVHRYMSLP 289
            ||:: .:||...        ||.:    |......| .::.|.|...|.:....|.:|.|.::..
 Frog   242 TCHL-PRADAFH--------IFRD----PLTGDLPWPGLIFGLTVLATWVWCTDQVIVQRSLAAK 293

  Fly   290 TLKMARASI---AFLVVGAAFFISLLCYLGLLIFHAYRDC-DPLS----AGLIMNDDQLV-PLFV 345
            .|..|:...   .:|.:...||:.|...:...:|.....| ||..    .|:.::...:. |..|
 Frog   294 NLSHAKGGSVLGGYLKILPMFFVVLPGMISKALFPDEVGCVDPAECLKYCGVEVSCSNIAYPKLV 358

  Fly   346 VNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQD----LVRGCFKMELGEWASTIVVKG 406
            :..|  ..|:.||.||.|..|.:|||:...||.|.:...|    :.|...:.||     .||.:.
 Frog   359 ITLL--PVGLKGLMIAVIMAALMSSLTSIFNSASTIFTLDVWLRIRRNAKEQEL-----MIVGRV 416

  Fly   407 SIVVLGLLAFAMVFVLEKV-SGVL-SISVSLAAIAASSTFGIFTVGMLVPWANTVGTAVGGIASV 469
            .|::|.:::...:.:::.. ||:| ....|:.:..:.....||.:.:.:...|..| |..|:...
 Frog   417 FILILVVISILWIPIIQAANSGLLFDYMQSVTSYLSPPITAIFILAIFIKRVNEPG-AFWGLIIG 480

  Fly   470 LLTGWISFGSQFAAASGQLGSQRLPVSVEGCLANASVAENAWVAEEEVFPLYRLSYHWISPIGVL 534
            ||.|.......|...:...|.:.|..||                .::|..|    |..|...|:.
 Frog   481 LLVGLTRMIMDFVYQAPSCGEEDLRPSV----------------LKDVHYL----YFAIFLFGLT 525

  Fly   535 TVVVVGSLVSLVT-----------------KPTDIKSLDSDL-----------ITPVIHR 566
            .:|.|  ::||.|                 .|...:.|::||           |.|||.:
 Frog   526 AIVCV--VISLCTPAIPEQDLARMTWWTRNSPIYKEDLENDLQQEPDPAEIPTIIPVIEK 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 128/577 (22%)
slc5a9XP_002931459.1 SLC5sbd_SGLT4 21..679 CDD:271380 142/641 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110690343
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.