DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and slc5a11

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_004918107.1 Gene:slc5a11 XenbaseID:XB-GENE-1010719 Length:674 Species:Xenopus tropicalis

Alignment Length:629 Identity:149/630 (24%)
Similarity:248/630 (39%) Gaps:159/630 (25%)


  Fly     8 TVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRNLRV 72
            |||..|.:...:..:.:||:  .|.:::.|                     .:..|.:..:::..
 Frog    25 TVDIVVLVLYFVFVLGVGLW--SICRTKRG---------------------TVKGYFLAGKDMAW 66

  Fly    73 FPVGMSLIASCISAVAIIGTPSE---------IYNYGTQYCFIVIALVLQGLAVSYIYLPVFSAL 128
            :|||.||.||.:.:...||....         .|.:...:|.         ||:::::||::.:.
 Frog    67 WPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCV---------LALAWLFLPIYISA 122

  Fly   129 QVTSSYEYLEMRFHSAIRSIVSIIFILDVVLYLPFLA--YLPALALNQVSGMNMYLIEAFIIVIC 191
            .||:..|||:.||......|...|..|.:.::.....  |..||.:.|....::|:....::||.
 Frog   123 GVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVIT 187

  Fly   192 VIYTVLGGLKAVVHTDIWQVVIMFASVLTIVVLATCYIDD------QADFLE------------G 238
            .||||.|||.||::||..|.|||....|  :::|..:|:.      |..:.:            |
 Frog   188 AIYTVAGGLAAVIYTDTLQTVIMIIGAL--ILMAYSFIEIGGFEALQEKYFQAIPNTHSGNSTCG 250

  Fly   239 LVRGGRL-IFSETNPSPFARHTVW-SVVIGNT----FYWTSLNAVHQTVVHRYMSLPTLKMARAS 297
            :.|.... ||.:    |......| .|::|.|    :||    ...|.:|.|.:|...|..|:..
 Frog   251 IPREDAFHIFRD----PVTSDLPWPGVLVGMTIPSLWYW----CTDQVIVQRSLSAKNLSHAKGG 307

  Fly   298 ---IAFLVVGAAFFISLLCYLGLLIFHAYRDC-DP-LSAGLIMN----DDQLVPLFVVNSLGHVY 353
               .|.|.|...|.:.|...:..::|.....| || |...:..|    .|...|..|:..|  ..
 Frog   308 SLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELL--PT 370

  Fly   354 GMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKMELGEWASTIVVKGSIVVLGLLAFAM 418
            |:.||.::.:..|.:|||:...||.|.:...||.|. .:....||...||  |.:.||.|:..::
 Frog   371 GLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRH-IRPRSTEWELMIV--GRVFVLALVVVSI 432

  Fly   419 VFV--------------LEKVSGVLSISVSLAAIAA-----SSTFGIFTVGMLVPWANTVGTAVG 464
            :::              ::.:|..|...|::..||.     ::..|.|       |..|:|.|||
 Frog   433 LWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAF-------WGMTIGLAVG 490

  Fly   465 GIASVLLTGWISFGSQFAAASGQLGSQRLPVSVEGCLANASVAENAWVAEEEVFPLYRLSYHWIS 529
            .|..||         .|...:.|...   |.:..|.:.                   .:.|.::|
 Frog   491 LIRMVL---------DFIYVAPQCDQ---PDTRPGVVK-------------------YVHYLYLS 524

  Fly   530 PI-GVLTVVVVGSLVSLVTKP---------TDIKSLDSDLITPV 563
            .| |:||::||.: ||:.|:|         |.....|::::.||
 Frog   525 MILGLLTLIVVVA-VSIWTEPPSKQMISRLTWFSRFDTEVVGPV 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 134/585 (23%)
slc5a11XP_004918107.1 SLC5sbd_SGLT6 27..674 CDD:271381 147/628 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109687528
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.