DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31668 and slc5a3a

Sequence 1:NP_001097055.2 Gene:CG31668 FlyBaseID:FBgn0051668 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001153309.1 Gene:slc5a3a ZFINID:ZDB-GENE-090312-3 Length:671 Species:Danio rerio

Alignment Length:652 Identity:142/653 (22%)
Similarity:250/653 (38%) Gaps:176/653 (27%)


  Fly     8 TVDYAVFLGVTILSIAIGLYFGFIRKSRNGPKTTTPTNEAPERRHQNFGSKKMNDYMMGSRNLRV 72
            |::.|..:.|.:..:.: |.|||....|                 .|.|:  ::.|.:..|::..
Zfish     4 TMEAADIIVVAMYFVLV-LCFGFFSMWR-----------------ANRGT--VSGYFLAGRSMNW 48

  Fly    73 FPVGMSLIASCISAVAIIGTPSEIYNYGTQYCFIVIA------LVLQGLAVSYIYLPVFSALQVT 131
            |.:|.||..|.|.:...||    :...|......|.|      |:||  .:.::::||:....|.
Zfish    49 FVIGASLFVSNIGSEHFIG----LAGSGAASGLAVGAWEFNAILLLQ--LLGWVFIPVYIHSGVY 107

  Fly   132 SSYEYLEMRFHSAIRSI--VSIIFILDVVLYLPFLAYLPALALNQVSGMNMYLIEAFIIVICVIY 194
            :..|||..||......|  .|:..:|.:...|....|..||.:.:..|.|:||....:|.:..:.
Zfish   108 TMPEYLSKRFGGNRLKIYFASLTLLLYIFTKLSVDLYSGALFIQESLGWNLYLSIILLITLTALL 172

  Fly   195 TVLGGLKAVVHTDIWQVVIMFASVLTIVVLA---------------------------------- 225
            ||.|||.||::||..|..:|.:..|.::.::                                  
Zfish   173 TVTGGLVAVIYTDTLQAFLMISGALCLMAISLVKVGGLEGLRTKYMNALPNITFITLENNLTYSN 237

  Fly   226 TCYIDDQADFLEGLVRGGRLIFSETNPSPFARHTVW-SVVIGNT----FYWTSLNAVHQTVVHRY 285
            :|:::.:||..: |:|           ||..:...| :.::|.|    :||    ...|.:|.|.
Zfish   238 SCHVNPKADSFK-LLR-----------SPLDKDLPWPAFLLGQTPASIWYW----CADQVIVQRV 286

  Fly   286 MSLPTLKMARAS---IAFLVVGAAFFISLLCYLGLLIF----------HAYRDCDPLSAG----- 332
            ::...:..|:.|   ...|.|...|.|.:...:..::|          |..:.|:. .||     
Zfish   287 LAARNIAHAKGSTLLAGVLKVLPMFIIVIPGMISRVLFADELACIGPEHCMQVCNS-RAGCTNTA 350

  Fly   333 ---LIMNDDQLVPLFVVNSLGHVYGMPGLFIAGIFGASLSSLSVYLNSTSLVILQDLVRGCFKME 394
               |:||   ::|:          |:.||.:|.:..|.:|.|....||.|.:...|:    :|| 
Zfish   351 YPRLVMN---IMPV----------GLRGLMMAVMLAALMSDLDSIFNSASTIFTLDI----YKM- 397

  Fly   395 LGEWAST--IVVKGSIVVLGLLAFAMV---FVLEKVSGVLSISVSLAA------IAASSTFGIFT 448
            :...||:  ::|.|.:.|:.::|.::.   ||:|...|.:.:.:...:      |||     :|.
Zfish   398 IRHQASSKELMVVGRLFVVLIVAISIAWVPFVIEMQGGQMFLYIQEVSDYLTPPIAA-----LFL 457

  Fly   449 VGMLVPWANTVGTAVGGIASVLLTGWISFGSQFAAASGQLGSQRLPVSV----EGCLANASVAEN 509
            :|:|....|..|...||...::                 ||..||.::.    ..|   .||.:.
Zfish   458 LGVLWKRCNETGAFWGGFVGLI-----------------LGIVRLILAFVYREPDC---DSVDDR 502

  Fly   510 AWVAEEEVFPLYRLSYHWISPIGVLTVVVVGSLVSLVTKPTDIKSLDSDLITPVIHRFLPKECFE 574
            ....::..|........|:|  |.:.||     |||.|.|...:.:....:..:.:|..|.:...
Zfish   503 PAFIKDVHFMYVAAVLFWVS--GFVMVV-----VSLCTNPPSKEQISKTTLWGLRNRNQPADTKA 560

  Fly   575 QG 576
            :|
Zfish   561 KG 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31668NP_001097055.2 SLC5sbd_NIS-SMVT 9..531 CDD:271383 130/605 (21%)
slc5a3aNP_001153309.1 SLC5-6-like_sbd 9..671 CDD:294310 140/648 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110708709
eggNOG 1 0.900 E1_COG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.