DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and zgc:152938

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio

Alignment Length:307 Identity:67/308 (22%)
Similarity:109/308 (35%) Gaps:92/308 (30%)


  Fly     8 LIQEVSKRRCLWDTNMSISYRNQD--AALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQ- 69
            ||..||.||.|:|.| .|.|::.|  .|| |..:|:.:...|...|.::|.:||:|..:.|:.| 
Zfish    60 LISLVSDRRELFDQN-HIDYKHIDKREAL-WQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQC 122

  Fly    70 ---QKRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLDLDND 131
               |...:...|.:.:.:||:                 ..::||..|....:             
Zfish   123 TGEQTPKKKKTWKFMKMMEFL-----------------ATSSEQRRVHSSVK------------- 157

  Fly   132 DSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPTLPIHLPRHQQFLPRP 196
            :|.|            .|...|.|:| ||...::|:.|.                        .|
Zfish   158 ESAD------------EVGDGSESEK-SLSISVESAVSS------------------------EP 185

  Fly   197 PPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKN------DSDLS-FLMSMMPHVKSLSA 254
            ...:.:.|:|..:|.    .:..|.  |:|...:.:.:.      :.|:| ||||:.|.::.|..
Zfish   186 VQANSKKRKRSVTPD----FVEKYL--AAKEVRDREREECRKQRMEDDISLFLMSLAPVIRRLPP 244

  Fly   255 ISNLKFRMEMARVLVE----LREEDQHMLAAAGPEDVLERSMPKLTP 297
            ......:|...:||.|    |.:..|...|...||.......|...|
Zfish   245 SKQSSVKMRFHQVLHEVEYGLSDASQPPSAQHCPESNHRAPTPDTPP 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 28/89 (31%)
BESS 236..270 CDD:281011 11/35 (31%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 25/70 (36%)
BESS 226..260 CDD:281011 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.