DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and si:ch211-207i20.3

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio

Alignment Length:305 Identity:65/306 (21%)
Similarity:112/306 (37%) Gaps:96/306 (31%)


  Fly     1 MKSDNYRLIQEVSKRRCLWDTNMSISYRN--QDAALQWASVAQIMQQDVSICKKRFKGMRDSYRA 63
            :|.|...|:..||:.:.|:|.|.| .|:|  :..|| |..:|..|..||...|.::|.:||:|  
Zfish    28 VKMDAELLLFLVSENKELFDKNHS-EYKNTKRKEAL-WQGIADKMGVDVEEVKAKWKNLRDTY-- 88

  Fly    64 EVRKIQQKRIEM------------SHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEP 116
                .::||:|.            ..|.|.|.::|:                      .|.....
Zfish    89 ----TRKKRLEQDGSRSGRAAKKKKQWKYMRVMDFL----------------------DPATEHR 127

  Fly   117 TRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLSPT 181
            :.::|..|:     ||..|               :|||::..|.......:|..|.||       
Zfish   128 SGILDSKIE-----DDEPD---------------EDSGAEPASTSTGTSVTSPEAMRS------- 165

  Fly   182 LPIHLPRHQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGY-ASQASKSTTEPDLKNDSDLSFLMSM 245
                              |...|||    |..:.||..| |::.:|...:.:.:.|....||.|:
Zfish   166 ------------------SIVKRRR----SETLELLEKYLATKDAKDREKDEQQQDEVDLFLRSL 208

  Fly   246 MPHVKSLSAISNLKFRMEMARVL--VELREEDQHMLAAAGPEDVL 288
            .|.::.|.|......::::.::|  .|..:.....:::..|.:.|
Zfish   209 APALRRLPASKQSLVKLQIQKILHDAEFGQPSFPQISSVSPSNQL 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 28/98 (29%)
BESS 236..270 CDD:281011 8/36 (22%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 28/117 (24%)
BESS 199..233 CDD:308542 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.