DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and Adf1

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster

Alignment Length:302 Identity:53/303 (17%)
Similarity:103/303 (34%) Gaps:99/303 (33%)


  Fly     8 LIQEVSKRRCLWDTNMSISYRN-QDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQK 71
            ||:.|.....::|.: ..:|:: ...|..|..:|:.:......|.||:|.:||.:..|::..|:.
  Fly    16 LIEAVKLNPVIYDRS-HYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQES 79

  Fly    72 RIEMSHWPYFRSLEFM----------------------RQIFDPEGLVPFPPEPFVMNTEQPEVF 114
            |     |.||:.::|:                      .|:.||              ::|.:..
  Fly    80 R-----WRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADP--------------SQQQQAQ 125

  Fly   115 EPTRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQDLS 179
            :.|                     :.|||                 .:|.:.|   |..|.|.|:
  Fly   126 QQT---------------------VVDIF-----------------AQPFNGS---ATTSAQALT 149

  Fly   180 PTLPIHLPRHQQFL------PRP---PPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKN 235
            ....|.:....|..      .:|   .||.||.|..:....|.:..:..:.:..|::.:.     
  Fly   150 HPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQNNVSQAVSA----- 209

  Fly   236 DSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVELREEDQH 277
             .|.||.|.:...:.:|......:.::.:.:.|.:::...||
  Fly   210 -EDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQH 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 22/106 (21%)
BESS 236..270 CDD:281011 6/34 (18%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192560
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.