DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and CG6163

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster

Alignment Length:282 Identity:55/283 (19%)
Similarity:88/283 (31%) Gaps:127/283 (45%)


  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQ----------DAALQWASVAQIMQQDVSICKKRFKGMRDSY 61
            |:|..:..|..|| .....|.:.|          :||::......:||...||.|:|:       
  Fly   226 RIIDAIKTRPSLW-AGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRY------- 282

  Fly    62 RAEVRKIQQKR-IEMSH------WPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRL 119
               |.::|::| .:.||      |.:|..:.|||:|.                .::.:..|.|| 
  Fly   283 ---VDELQKERHAQYSHQSFRSTWEHFDRMSFMREIL----------------LKKVDEREQTR- 327

  Fly   120 VDFAIDLDLDNDDSVDFEIIEDIFK-------------------REPSVPQDSGSDKGSLIKPLD 165
                             |.|::|..                   |.|..|       ..|::...
  Fly   328 -----------------EQIQEIVSEQQHHQQTQHHPSQHLHHYRPPQPP-------AGLVEHAQ 368

  Fly   166 SSSSG--AHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKST 228
            ....|  .|...:...|||.:|.|:|.|.:          |||                      
  Fly   369 DMPIGLVQHHHQEGHHPTLAMHHPQHSQPI----------RRR---------------------- 401

  Fly   229 TEPDLKNDSDLSF-LMSMMPHV 249
                :|::|||.: ...|:.||
  Fly   402 ----VKHESDLEWDPFEMILHV 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 26/101 (26%)
BESS 236..270 CDD:281011 6/16 (38%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 26/101 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192156
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.