DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and madf-9

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans

Alignment Length:308 Identity:70/309 (23%)
Similarity:110/309 (36%) Gaps:81/309 (26%)


  Fly     5 NYRLIQEVSKRRCLWDTNMS----ISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEV 65
            |.|||.||..|..|:|.:..    :|:||.    .|..:|:.::......|.|:|.:||.|:.|.
 Worm    50 NIRLIAEVKARPFLYDQSDEGYNLLSWRNS----AWNEIAENLETTSEHVKTRWKTLRDRYKKEE 110

  Fly    66 RKIQQKRIEMSHWPYFRSLEFM------RQIFDPEGLVPFPPEPFVMNTEQPEVF-EPTRLVDFA 123
            :|.:..: :.|.|.:.|.|:|:      |...:.:.           |..:|.|. ||       
 Worm   111 KKERVSK-KASSWVFQRPLKFIQAHLKDRHTDETDS-----------NQSEPAVKPEP------- 156

  Fly   124 IDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAHRSDQ----------DL 178
                  |......|......:.|....|||....||..:...||:|.|..:..          :.
 Worm   157 ------NGHVSPMEAAMSFIENELIRTQDSSKSSGSTGEMESSSASTASSASSSKNTGTQEGGEA 215

  Fly   179 SPTLPIHLPRHQQFLPRPP---------PPSKRGRRRKTSPSNDVPLLNGYASQASK-------- 226
            |...|..||......|.|.         |..||.|...|.....|...|..|:.|:.        
 Worm   216 SVITPPPLPIPMAVTPSPSATSSASNGGPAVKRSRVSITEGMTPVASRNAAAAAAASLGLSFFPG 280

  Fly   227 ----STTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFR-MEMARVLV 269
                :||..:.:::     :.:.|..:|    :|.|..| .|:|::.|
 Worm   281 LSQWATTREEEEDE-----IFARMISIK----LSKLDARTKEVAKLQV 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 27/94 (29%)
BESS 236..270 CDD:281011 8/36 (22%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47828
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.