DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and madf-3

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans

Alignment Length:359 Identity:88/360 (24%)
Similarity:126/360 (35%) Gaps:118/360 (33%)


  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQ-WASVAQIM--QQDVSICKKRFKGMRDSYRAEVR 66
            |.|||:.|...|||:| |....|||.:...: |..:..::  ..|..:...|:|.:||.|..|.|
 Worm     7 NLRLIEAVRHSRCLFD-NTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEKR 70

  Fly    67 KIQQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVF----EPTRLVDFAIDLD 127
            | |:...|.|.|.||:.|.|:    ||.            .|::.|:.    |||          
 Worm    71 K-QKYGNEKSSWQYFKHLHFL----DPH------------MTDRAEISPSRKEPT---------- 108

  Fly   128 LDNDDSVDFEIIEDIF--------KREPSV-----PQDSGSD-----KGSLIKPLDSSSS----- 169
                 .|..:|.|..|        :|.|.:     |:....|     .|.:|..|....:     
 Worm   109 -----GVHEKIAEPCFGKNLILEVRRHPCLYDVRDPKYRHGDCRTQAWGMIIDKLRYPGTVPSIY 168

  Fly   170 ---GAHR----------------SDQDLS--------PTLPIHLPRHQQFLPRPPPPSKR----- 202
               ..||                :.||:|        ..:..||...|  |.|.....||     
 Worm   169 KQWKKHRDRYVREKRRLRNLGDPNVQDVSTWEMYDDMAWIDQHLDEQQ--LSRCARSLKRGGNND 231

  Fly   203 -GRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMAR 266
             |.:.:.|...|......|...|.|.....|:..|.|.:|         |.|.:|:|:...|.||
 Worm   232 GGNQDEMSDYGDYDDDINYVMMAEKRPNNGDVLLDGDSAF---------SASIVSDLRTLGEEAR 287

  Fly   267 VLVELREEDQHMLAAAGPEDVLERSMPKLTPAPN 300
            ::.    :.|.|:       :||.:.|..|||||
 Worm   288 IIA----KQQIMI-------LLESAKPPSTPAPN 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 30/87 (34%)
BESS 236..270 CDD:281011 10/34 (29%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 32/103 (31%)
MADF 122..212 CDD:214738 13/90 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.