DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11723 and madf-2

Sequence 1:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans

Alignment Length:317 Identity:58/318 (18%)
Similarity:101/318 (32%) Gaps:107/318 (34%)


  Fly     8 LIQEVSKRRCLWDTN---------------------------MSISYRNQDAALQWASVAQIMQQ 45
            ||..:..|..:||.|                           |.|.:..:|...||         
 Worm    12 LINAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVRSQW--------- 67

  Fly    46 DVSICKKRFKGMRDSYRAEVR-----KIQQKRIEMSHWPYFRSLEFM-----RQIFDP-EGLVPF 99
                     |.::|::..::|     |..:..::...|.::|.|.|:     :::.|. |.....
 Worm    68 ---------KNLKDTFVRKLRWVHEGKYMEDAMKEPTWKFYRMLTFLDEKEAKRLGDTCEHTYEL 123

  Fly   100 PPEPFVMNTEQPEVFEPTRLVDFAIDLDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLI--- 161
            .|............:|||            :.:...|::..:  :..|.:.|.|..|...:.   
 Worm   124 APNSTSCGQRAQISYEPT------------STEEKMFQMFNN--QPPPQLSQQSMIDSSQIATCS 174

  Fly   162 -KPLDSSSS-----------GAH----RSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSP 210
             :|..:|||           |.|    ||....|..|...|....:     .|..|:..||:.  
 Worm   175 NEPKMTSSSTFVTSSTSLKRGVHYSPTRSPNGSSSGLEEELEDEDE-----QPGRKKSCRRQV-- 232

  Fly   211 SNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMARV 267
            ||..|:         :..|.|.:.:..:.....:|:  ..:|..|:|.:.||...||
 Worm   233 SNIQPM---------QVITTPPVAHQDEFDHFGAMV--AANLRRIANEQGRMNALRV 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11723NP_001259906.1 MADF 7..91 CDD:214738 19/120 (16%)
BESS 236..270 CDD:281011 8/33 (24%)
madf-2NP_492896.1 MADF 11..107 CDD:214738 19/113 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47871
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.