DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or98b

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster

Alignment Length:415 Identity:82/416 (20%)
Similarity:165/416 (40%) Gaps:58/416 (14%)


  Fly     9 IADHFYRIPRISGLIVGLWPQRIRGGGGR-PWHA--HLLFVFAFAMVVVGAVGEVSYGCVHLDNL 70
            :.|.|.|:......::||.....:..|.| ||.:  .:|.|.:|..:.      :::|..::.|:
  Fly     2 LTDKFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFMPLT------IAFGLQNVQNV 60

  Fly    71 VVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSL 135
            ....::.|......:.:.|:.:|....:.:..|:.:...:|..........|:|   |..:|...
  Fly    61 EQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIV---TRESRRDQ 122

  Fly   136 LLLSSG-----TATNAAFTLQPLIMGL-YRWIVQLPGQTELPFNIILPSFAVQPGVFP------L 188
            .:.:..     ||..:|..:.||.|.: |:...:|  |.:.||          |.|:|      .
  Fly   123 FISAMYAYCFITAGLSACLMSPLSMLISYQRTGEL--QPKFPF----------PSVYPWDNMKLS 175

  Fly   189 TYVLLTASGACTVFAFSF----VDGFFICSCLY-ICGAFRLVQQDIRRIFADLHGDSVDVFTEEM 248
            .|::......|.....:.    ||..| ||..: :|..|::.:..:      :|.:..:  |:|.
  Fly   176 NYIISYFWNVCAALGVALPTVCVDTLF-CSLSHNLCALFQIARHKM------MHFEGRN--TKET 231

  Fly   249 NAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYIC 313
            :..::|    |.:.:...::....|...|..:: ..|::|:..||.....:..|....:.|.|..
  Fly   232 HENLKH----VFQLYALCLNLGHFLNEYFRPLI-CQFVAASLHLCVLCYQLSANILQPALLFYAA 291

  Fly   314 YIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMI---LRRSQRAKTIAVP 375
            :..|.:.|:.:|||.|:.:..........:|:..|........:::..:   :.||.....|...
  Fly   292 FTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPIDGY 356

  Fly   376 FFTPSLPALRSILSTAGSYITLLKT 400
            ||..:...|.:|:.||.||:|||::
  Fly   357 FFEANRETLITIVRTAISYVTLLRS 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 64/343 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 63/342 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.