DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or98a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster

Alignment Length:389 Identity:64/390 (16%)
Similarity:134/390 (34%) Gaps:93/390 (24%)


  Fly    39 WH---AH---------LLFVFAFAMVVVGAVGEVSY----GCVHLDNLVVALEAF--CPGTTKAV 85
            ||   .|         |:|.:....:.:|.:  :|:    .....:.|:..::.|  ..|....|
  Fly    33 WHTPATHKIIYYITSCLIFAWCAVYLPIGII--ISFKTDINTFTPNELLTVMQLFFNSVGMPFKV 95

  Fly    86 CVLKLWV--FFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAF 148
            ....|::  |:::.:..:|:.:|...:   ..|.|..:.:|    ..|:..|:.....||...:.
  Fly    96 LFFNLYISGFYKAKKLLSEMDKRCTTL---KERVEVHQGVV----RCNKAYLIYQFIYTAYTIST 153

  Fly   149 TLQPLIMGLYRWIVQLP--------------GQTELPFNIILPSFAVQPGVFPLTYVLLTASGAC 199
            .|...:.|...|.:..|              ...|....:...:..:...::||.|.|:      
  Fly   154 FLSAALSGKLPWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLI------ 212

  Fly   200 TVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHN 264
                                  .|:..:.:|     |..:|:...:.:.:||....|.:.::.||
  Fly   213 ----------------------LRVHLKLLR-----LRVESLCTDSGKSDAENEQDLIKCIKDHN 250

  Fly   265 AIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGG 329
            .|||:...:....|..:.:.||.....|..::::::......:||..:.||...:.|.|.:||..
  Fly   251 LIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVC 315

  Fly   330 NHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGS 393
            :.:.:....:...::...|.......:..:...|:.:|                 :||..||||
  Fly   316 DLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQ-----------------KSIAFTAGS 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 55/341 (16%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 57/347 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51472
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.