DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or92a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster

Alignment Length:385 Identity:85/386 (22%)
Similarity:154/386 (40%) Gaps:86/386 (22%)


  Fly    57 VGEVSYGCVHLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAI-LWESRRQ--- 117
            |||::|..||:.:....|||    |..|.|:  .:.|....:::...|.|.|.: |.:..::   
  Fly    65 VGEIAYFIVHIMSTTTLLEA----TAVAPCI--GFSFMADFKQFGLTVNRKRLVRLLDDLKEIFP 123

  Fly   118 ---EAQRM--LVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPG----QTELPFN 173
               ||||.  :.......||:..|.........::|:..|.|....::  .|.|    :....|:
  Fly   124 LDLEAQRKYNVSFYRKHMNRVMTLFTILCMTYTSSFSFYPAIKSTIKY--YLMGSEIFERNYGFH 186

  Fly   174 IILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGA----------------- 221
            |:.|               ..|....||:.||:   :.:..|.|:.|.                 
  Fly   187 ILFP---------------YDAETDLTVYWFSY---WGLAHCAYVAGVSYVCVDLLLIATITQLT 233

  Fly   222 --FRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMH 284
              |..:..|:.......|       |:|.|.:..|.|   |..|...:|...::...|:.::|.:
  Fly   234 MHFNFIANDLEAYEGGDH-------TDEENIKYLHNL---VVYHARALDLSEEVNNIFSFLILWN 288

  Fly   285 FLSAAFVLC--------STILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVAD 341
            |::|:.|:|        |.:.||:|         |..:..|:|.|:|:.|:.|:.:..||:.:..
  Fly   289 FIAASLVICFAGFQITASNVEDIVL---------YFIFFSASLVQVFVVCYYGDEMISSSSRIGH 344

  Fly   342 VLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSILSTAGSYITLLKT 400
            ..::..|..|..:.::::..|:.|||:..:|..|.|.| |......::|.:..:..||:|
  Fly   345 SAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLRT 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 76/364 (21%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 76/361 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52674
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.