DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or88a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster

Alignment Length:263 Identity:61/264 (23%)
Similarity:92/264 (35%) Gaps:51/264 (19%)


  Fly   177 PSFAVQPGVFPLTYVLLTASGACTVFA--FSFVDGFFICSC-----LYI-----------CGAFR 223
            |.|.    |.||...|||..|..|..|  ...:.|:..|..     .|:           ||...
  Fly   150 PMFC----VVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSF 210

  Fly   224 LVQQDIRRIFADLHG----------------DSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTD 272
            .|..|  .:|..:.|                |.....|:|....|..||  :|:|...:...|  
  Fly   211 FVTFD--NLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRL--LVQRQQLLNGLC-- 269

  Fly   273 LTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYIC-YIIAALTQL---FLYCFGGNHVS 333
              |::..|..:.||.:.||...::...:...|..|.:..|. ||:..|..:   |..|..|..:.
  Fly   270 --RKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLVGFTFEICLRGTQLE 332

  Fly   334 ESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSYITL 397
            ::|..:...|...|||....|.||..|:..:..||.:.: |......::.....|:..|....|.
  Fly   333 KASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTF 397

  Fly   398 LKT 400
            ||:
  Fly   398 LKS 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/254 (23%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52694
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.