DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or85e

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster

Alignment Length:473 Identity:95/474 (20%)
Similarity:163/474 (34%) Gaps:118/474 (25%)


  Fly     7 PAIADHFYRIPRISGLIVGL---------------WPQRIRGGGGRPWHAHLLFVFAFAMVVVGA 56
            ||...:.:|      |::||               ||:|:.                    ::|.
  Fly    22 PARESNLFR------LLMGLQLANGTKPSPRLPKWWPKRLE--------------------MIGK 60

  Fly    57 V------GEVSYGCVHLDNLV--VALEAFCPGTTKAV---CVLKLWVFFR--SNRRWAELVQRLR 108
            |      ..|.:..:||..|.  ..|:....|..:|:   ..:.:..||.  ....|....:||.
  Fly    61 VLPKAYCSMVIFTSLHLGVLFTKTTLDVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLL 125

  Fly   109 AILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQ--LPGQTELP 171
            |.:....|:.....|.|:...::..:..:..:.|..    .:...::|:..|.|.  :.|...||
  Fly   126 AYMEHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVV----WIMSCLLGVISWGVSPLMLGIRMLP 186

  Fly   172 FNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFAD- 235
            .....|..|:.||.:...|.............|.|....|:...|.:.|.|.::...::.:.|. 
  Fly   187 LQCWYPFDALGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHT 251

  Fly   236 --LHGDSVDVFT------------EEMNAEV-------------------------RHRLAQVVE 261
              |.|:||:..:            .|:|..|                         .:.|.:.:.
  Fly   252 KLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIR 316

  Fly   262 RHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQL---- 322
            .|..|:....:|...|:...|:..|...|.||      :|....:||...:..|:..|..|    
  Fly   317 LHRFILHCSQELENLFSPYCLVKSLQITFQLC------LLVFVGVSGTREVLRIVNQLQYLGLTI 375

  Fly   323 -----FLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSL 381
                 |.||  |..:|..|....|..:...|:|.....|:.||:.|..|:||..: |..|:...:
  Fly   376 FELLMFTYC--GELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDV 438

  Fly   382 PALRSILSTAGSYITLLK 399
            ..|||:::.|.|::|||:
  Fly   439 NRLRSVITQAFSFLTLLQ 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 77/382 (20%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 70/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.