DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Orco

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster

Alignment Length:523 Identity:106/524 (20%)
Similarity:185/524 (35%) Gaps:166/524 (32%)


  Fly     1 MTDSGQPAIADHFYRIPRISGLIVGLWPQRIRG-----------GGGRPW------HAHLLFV-- 46
            ||.|.||:         :.:||:..|.| .||.           .||..:      ..||:|:  
  Fly     1 MTTSMQPS---------KYTGLVADLMP-NIRAMKYSGLFMHNFTGGSAFMKKVYSSVHLVFLLM 55

  Fly    47 -FAFAMVVVG----AVGEVSYGCVHLDNLVVALEAFCPGTTKAVCV----------LKLWVFFRS 96
             |.|.:|.:.    .|.|:|      .|.:..| .|....||.:.:          |.:|....:
  Fly    56 QFTFILVNMALNAEEVNELS------GNTITTL-FFTHCITKFIYLAVNQKNFYRTLNIWNQVNT 113

  Fly    97 NRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTA------------------ 143
            :..:||...|..:|.....|:  ...||.|.|.|         |.||                  
  Fly   114 HPLFAESDARYHSIALAKMRK--LFFLVMLTTVA---------SATAWTTITFFGDSVKMVVDHE 167

  Fly   144 TNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTA--SGACTVFAFSF 206
            ||::..::         |.:||.::..|:|.....|.:....|.:.|||.:.  |..|.|...|:
  Fly   168 TNSSIPVE---------IPRLPIKSFYPWNASHGMFYMISFAFQIYYVLFSMIHSNLCDVMFCSW 223

  Fly   207 VDGFFICSCL-YICGAFRLVQQ---------------------------------------DIRR 231
            :  .|.|..| ::.|..:.:.:                                       |:..
  Fly   224 L--IFACEQLQHLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSG 286

  Fly   232 IFAD---------------------------LHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDF 269
            |::.                           ::|.:.:..|::....||..:...||||..::..
  Fly   287 IYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRL 351

  Fly   270 CTDLTRQFTVIVLMHFLSAAFVLCSTILDIM---LNTSSLSGLTYICYIIAALTQLFLYCFGGNH 331
            ...:...:...:|:|.|::...|  |:|...   :|..::...|.:.|:..||.|:|.:|..||.
  Fly   352 VAAIGDTYGAALLLHMLTSTIKL--TLLAYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNR 414

  Fly   332 VSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTIA-VPFFTPSLPALRSILSTAGSYI 395
            :.|.|::|.:..|...||......:..:.::.::.|:|.:|: ..|||.||....|:|....:|.
  Fly   415 LIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYF 479

  Fly   396 TLL 398
            .:|
  Fly   480 MVL 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 82/424 (19%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 84/433 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.