DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or71a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster

Alignment Length:397 Identity:84/398 (21%)
Similarity:156/398 (39%) Gaps:68/398 (17%)


  Fly    26 LWPQR--IRGGGGRPWHA---HLLFVFAFAMVV-VGAVGEVSYGCVH-LDNLVVALEAFCPGTTK 83
            |||::  :.......|.|   |:.|.|.|.::: :.|:  .|....| .|.|::.|      ||.
  Fly    21 LWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAI--KSRDIQHTADVLLICL------TTT 77

  Fly    84 AV--CVLKLWVFFRSNR----RWA-----ELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLL 137
            |:  .|:.:|.:....:    .|:     ||..:....:|   |.|.:|.        ||:.:..
  Fly    78 ALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMW---RFEHRRF--------NRVFMFY 131

  Fly   138 LSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVF--PLTYVLLTASGACT 200
            ............:|||.        .:|.:  |||.:..|....||.:|  ...|...|...||.
  Fly   132 CLCSAGVIPFIVIQPLF--------DIPNR--LPFWMWTPFDWQQPVLFWYAFIYQATTIPIACA 186

  Fly   201 VFAFSFVDGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNA 265
            .........:::...|.:|  .|::.|.:.::   .|.|.          ::|.:..:::..|..
  Fly   187 CNVTMDAVNWYLMLHLSLC--LRMLGQRLSKL---QHDDK----------DLREKFLELIHLHQR 236

  Fly   266 IIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLN--TSSLSGLTYIC-YIIAALTQLFLYCF 327
            :......:....:.......|.::.::|.||..:.::  ...|.|...:. |::|.:.|:.|...
  Fly   237 LKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTI 301

  Fly   328 GGNHVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTA 391
            .||.|.:|:..:.|.:|:.:|...:.|.|:::||.:....|..|: |..||...||.....::.|
  Fly   302 YGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQA 366

  Fly   392 GSYITLL 398
            .|.:.||
  Fly   367 YSLLALL 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 68/340 (20%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 69/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53057
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.