DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or67d

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster

Alignment Length:255 Identity:53/256 (21%)
Similarity:100/256 (39%) Gaps:34/256 (13%)


  Fly   174 IILPSFAVQPGVFPLTYVLLTASGACTV-FAFSFVD-----GFFICSCLYIC----GAFRLVQQD 228
            |||....:   .||:.|:|:.......: |...|:|     |..|.:..::.    |.|.....|
  Fly   144 IILLGLVI---TFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGD 205

  Fly   229 IRRIFADLHGDSV-DVFTEEMN------------AEVRHRLAQVVERHNAIIDFCTDLTRQFTVI 280
            :.......|...: |:|..::.            .:||..|..::..|...........:.::::
  Fly   206 MYLFLFVTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIV 270

  Fly   281 VLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLY- 344
            :.:...:....|..||..|.:.....:.| |:.|  ||:| |:.:|..|..|..|:.....|:| 
  Fly   271 LFVQLSTTCVGLLCTISCIFMKAWPAAPL-YLLY--AAIT-LYTFCGLGTLVENSNEDFLSVIYT 331

  Fly   345 DMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAG--SYITLLKTFL 402
            :..||:...:..|:|:|:|.::|....:......| |....::..|.|  |:..:|..:|
  Fly   332 NCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAP-LSMNTALQLTKGIYSFSMMLMNYL 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 49/242 (20%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 50/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52637
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.