DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or59c

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster

Alignment Length:440 Identity:89/441 (20%)
Similarity:158/441 (36%) Gaps:123/441 (28%)


  Fly    10 ADHFYRIPRISG----------LIVGLWPQRIRGGG--GRPWHAHLLFVFAF-----------AM 51
            :|::|||....|          .|..||.......|  ..|....|.:|..|           ..
  Fly    24 SDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHFDRFTPTEFLTSLQ 88

  Fly    52 VVVGAVGEVSYGCV---------HLDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRL 107
            |.:..:|.|...||         .::.|:.:|:..|..||:             .|.:.::|.|:
  Fly    89 VDINCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQ-------------RRIFHKMVARV 140

  Fly   108 RAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTL-QPLI---MGLYR-WIVQLPGQ 167
            ..|           :::.|:|......|.|.:|..|..|.:.| .||:   .|.:: ||..:   
  Fly   141 NLI-----------VILFLSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASI--- 191

  Fly   168 TELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSCLYICGAFRLVQQDIRRI 232
              |.:.::  |......:...||.::..|             .|.|....:......::||.:. 
  Fly   192 --LEYCVV--SIGTMQELMSDTYAIVFIS-------------LFRCHLAILRDRIANLRQDPKL- 238

  Fly   233 FADLHGDSVDVFTEEMNAEVRH--RLAQVVERHNAIIDFCTDLTR---------QFTVIVLMHFL 286
                             :|:.|  ::...::.|..||. |:.:.|         ||.::.:...|
  Fly   239 -----------------SEMEHYEQMVACIQDHRTIIQ-CSQIIRPILSITIFAQFMLVGIDLGL 285

  Fly   287 SAAFVLC--STILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWY 349
            :|..:|.  :||..||.|.|         :|:|..|:.|..|....|:.|.|..|::.|:...|.
  Fly   286 AAISILFFPNTIWTIMANVS---------FIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWI 341

  Fly   350 KCDARTRKVILMILRRSQR-AKTIAVPFFTPSLPALRSILSTAGSYITLL 398
            ..|...:..:|..|.|:|: .:..|...|..|:.:..::...|.:.||::
  Fly   342 TADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIV 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 69/342 (20%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 74/378 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51602
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.