DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or22c and Or49a

Sequence 1:NP_523454.2 Gene:Or22c FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster

Alignment Length:385 Identity:70/386 (18%)
Similarity:143/386 (37%) Gaps:58/386 (15%)


  Fly    37 RPWHAHLLFVFAFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAV-----------CVLKL 90
            :||..:||....|.:..:....|.|.    :...::..|:.....:|.:           ..||.
  Fly    30 KPWWRYLLVRGYFVLCTISNFYEASM----VTTRIIEWESLAGSPSKIMRQGLHFFYMLSSQLKF 90

  Fly    91 WVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVG----LATTANRLSLLLLSSGTATNAAFTLQ 151
            ..|..:.:|..:|..||:. |:..:.|..::..|.    ..:|.|.|.:...     ......|:
  Fly    91 ITFMINRKRLLQLSHRLKE-LYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYF-----VMVVMALE 149

  Fly   152 PLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSC- 215
            ||:.....:::.. |:.:..:..|.|:........||.|||        .:...|....||.:. 
  Fly   150 PLVQSCIMYLIGF-GKADFTYKRIFPTRLTFDSEKPLGYVL--------AYVIDFTYSQFIVNVS 205

  Fly   216 ----LYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQ 276
                |::......:...:..:...|........||:.:.:.   ||.:::||..:|....|:...
  Fly   206 LGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---LASIIKRHQLMIRLQKDVNYV 267

  Fly   277 FTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVAD 341
            |.:::..:..:.:.:||......::...:..|::|:....:...|.::....|..:.:.|..:|.
  Fly   268 FGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAK 332

  Fly   342 VLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLLKTF 401
            ..::.:||:...|.:|.||:::.::||...|                |..|..|..|.||
  Fly   333 AAFESKWYEGSLRYKKEILILMAQAQRPLEI----------------SARGVIIISLDTF 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/343 (17%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 61/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52886
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.